KEGG   Cucurbita maxima (winter squash): 111498266Help
Entry
111498266         CDS       T05246                                 

Definition
(RefSeq) probable protein phosphatase 2C 8 isoform X1
  KO
K17500  integrin-linked kinase-associated serine/threonine phosphatase 2C [EC:3.1.3.16]
Organism
cmax  Cucurbita maxima (winter squash)
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cmax01009]
    111498266
Enzymes [BR:cmax01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     111498266
Protein phosphatases and associated proteins [BR:cmax01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    111498266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C PP2C_2
Motif
Other DBs
NCBI-GeneID: 111498266
NCBI-ProteinID: XP_023005142
Position
Unknown
AA seq 354 aa AA seqDB search
MADSAKSVLEEETSKLETKSKRGVDVEDADVTVKKFKTEATAGVADKTGDCTGRKLEAVN
GDEENKVIRMGVKFEIEADAAEDKGSRHTMEDAWVLLLDASLDFPGKLRCAHFAIYDGHG
GRLAAEYAQKHLHMNVLSAGLPRELLDVKATKKAILDGFRKTDESLLQESSAGGWQDGAT
AVCVWVLGQTVFVANVGDAKAVVARSSTTDKLSNNLNGGSSLKAIVLTREHKAIYPQERA
RIQKAGGVVGSNGRLQGRLEVSRALGDRQFKKLGVIATPDIHSFELTAREHFIILGCDGL
WGVFGPSDAVDFVQKLLQEGLPITSVSRRLVREAIRERRCKDNCTAMVIVFRPK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggccgatagcgctaaatcagttctcgaagaggaaacttcgaagcttgaaaccaaatcc
aagcgcggcgtagatgtcgaggatgctgatgtcactgtgaagaagtttaaaacggaagct
actgccggtgtagccgacaaaactggagactgtaccggcaggaagttggaagctgttaat
ggtgatgaagaaaataaggtcatcaggatgggagtcaagtttgagattgaagcggatgca
gcagaagataaagggtccaggcatacaatggaggatgcttgggttttgcttttggatgcg
agcttggattttcctgggaaattgagatgtgcacattttgctatctatgatggacatgga
ggtcggttagctgccgaatacgctcaaaagcatttgcatatgaatgttctctcagccggg
ttaccacgtgagttgttggatgtaaaagcaactaaaaaggcaatacttgatgggttccgg
aaaactgatgagtctcttcttcaagaaagttctgctgggggatggcaggatggtgctact
gctgtttgcgtttgggtattaggtcaaacggtttttgttgctaatgttggtgatgctaaa
gcagttgtagcacgatcttcgactactgataaattgtctaataatcttaatggaggaagc
tctttaaaggctattgttttgacaagggaacacaaggcaatctacccacaagaaagagct
cgtattcaaaaggctggtggcgttgttggttcaaatggtcgattgcagggccgtcttgaa
gtttctcgggcactcggagatcgccaatttaaaaagttgggcgttattgcaactccagac
attcattcttttgaattgactgctagggagcattttatcatcctcggatgtgatggactt
tggggggtttttggaccaagcgatgctgtcgattttgtccagaaattattgcaggagggc
ttgcccataacatcagtaagtcgacgtcttgtgagggaagctattcgtgaacggcgctgt
aaagataactgtactgcaatggtcattgttttcaggcccaagtaa

DBGET integrated database retrieval system