KEGG   Cucurbita maxima (winter squash): 111498711
Entry
111498711         CDS       T05246                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00100  Steroid biosynthesis
cmax01100  Metabolic pathways
cmax01110  Biosynthesis of secondary metabolites
Module
cmax_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:cmax00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    111498711
Enzymes [BR:cmax01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     111498711
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 111498711
NCBI-ProteinID: XP_023005820
UniProt: A0A6J1KYF4
Position
Unknown
AA seq 369 aa
MDLEFLLQLAIPSWEAVAILFIFFVYLAIAGSVLPGRIIPGVILPDRTRLHYRCNGLLSL
LVLVALLGIGVKMNYISPTAISDRGVELLSATFWFSVLATFLLCVAGHSSSSQSSSLKPC
ITGNFIHDWWFGMQLNPHFLGIDLKFFFVRAGMMGWLLINLSVLARSVLDATLSQSMILY
QTFCALYVLDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLTNKSELT
TAATIANCSVFLIGYLVFRGSNKQKHMFKKNNKALIWGRPPKVVGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGISSPIPYFYPTYLLLLLIWRERRDEARCAEKYKDIWAEYTKLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctggagtttcttcttcaacttgcaatcccctcttgggaagctgttgctatactt
ttcattttcttcgtttacttggcgattgctggctctgttctacctggaaggattatccca
ggagtgatcttgccggaccgcactaggcttcattatcgctgcaatggtctactctctctt
ctggtgcttgttgcacttcttgggattggtgttaagatgaattacatttcgcccactgca
atttcagatagaggggtggagctgttatccgcaaccttctggtttagtgtcctggcaaca
tttttactctgtgttgctggccacagttcaagtagtcaaagttcttccctaaagccctgt
atcacagggaactttattcacgattggtggtttggtatgcagttgaatcctcactttttg
ggcattgatctcaaatttttctttgtgagagctggaatgatggggtggctacttattaac
ctatcagttcttgccagaagtgttttggacgccaccttaagccaatcaatgattctctac
cagacattttgtgcgttatatgtcctggactacttcgttcacgaggagtacatgacctcc
acatgggacataattgctgaaagattaggcttcatgctggtgtttggagatcttgtttgg
attccttttacatttagcattcagggttggtggcttttaacaaacaagtctgagctaaca
acagctgctaccatagctaactgctcggtctttttaatcggatatcttgtgtttagagga
tctaacaagcaaaaacacatgtttaaaaagaacaacaaagcgcttatatggggtaggcct
cccaaagttgtaggaggaaagttgcttgcttctggttattggggaattgctaggcattgt
aattaccttggagacttgttgcttgcactttctttcagcttaccatgtgggataagctcc
ccaattccatacttttatcccacatatctcctccttctgctaatatggagagaaagacgg
gatgaagctcgatgcgctgagaaatataaagacatttgggcggagtataccaaactcgtc
ccttggagaatactgccttatgtttattag

DBGET integrated database retrieval system