KEGG   Cucurbita maxima (winter squash): 111499236Help
Entry
111499236         CDS       T05246                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00052  Galactose metabolism
cmax00500  Starch and sucrose metabolism
cmax01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmax00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    111499236
   00500 Starch and sucrose metabolism
    111499236
Enzymes [BR:cmax01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     111499236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 111499236
NCBI-ProteinID: XP_023006546
Position
Unknown
AA seq 578 aa AA seqDB search
MNFFTLLAILFGFSFCSLFIGNGPVVIQALHKIYPELQSLENGNDTTEIKQLHRTGFHFQ
PHRHWMNGPNGPMYFKGIYHLFYQYNPEGAVWGNIVWAHSISKDLINWKSLKPALSPSKP
FDINGCWSGSATVLPGLKPVILYTGIDTQNRQVQNYAIPANLSDPHLTEWVKPDNNPIVD
PGTEVNSSAFRDPSTAWLSLNGHWNTIIGSRSEQTGMAYLYRSRNFLNWTKVEQPLHSVP
NTGMWECPDFYPVSHFGRFGLDTSVMGNWFKHVLKVSLEMTRYEYYTVGKYYPMTDKYVP
DNTSADGWSGLRYDYGNFYASKSFYDPMKKRRVLWGWANESDSVQDDVSKGWAGIQAIPR
TVWLDPNGKQLLQWPIMELNRLRRKIVMMLNQKLVKGQNVEIKGITAAQADVEVIFSFSS
LDNAEAFDPSWVDAQAVCSQLGSTAQGGVGPFGLLTLASENLEEFTPVFFRIFKAEANHV
VLMCSDARSSSLKDGLYKPTFAGFVDIDLSSKKLSLRSLIDHSVIESFGGGGKTCITSRV
YPTKAVFGDAHLHVFNNGTESITVEYLSAWSMRSAWVN
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcttcactctcctagctattcttttcggattctccttttgttctctgtttatt
ggcaatggccctgtcgtcattcaagctctccataaaatctatcctgaattacagtctctc
gaaaatggcaacgacaccaccgagatcaagcagctccatcgaaccggcttccactttcaa
cctcatcgtcactggatgaacggcccgaatggcccaatgtatttcaagggaatctaccat
ctcttctaccaatacaaccctgaaggcgcagtttgggggaacattgtctgggctcactca
atttccaaagaccttatcaattggaagtcactcaaacccgcgctttccccctcaaagccc
tttgatatcaatggctgctggtctggctccgccaccgtcctccccggcctcaagcccgtc
attttgtacactggaatcgacacccagaatcgacaggtacaaaactacgccattccagcg
aacctctctgatccgcatctaaccgagtgggtcaaaccggataacaatccgattgttgac
ccgggtacagaggtcaatagtagcgcctttcgggacccgtcgacggcatggctaagcctc
aacggtcactggaacaccatcattggcagcaggagcgagcagacgggaatggcgtatttg
tatagaagtaggaattttttgaattggactaaggtggaacagcctttacattcggttccg
aatactggaatgtgggagtgccctgatttctatccagtttcccacttcggtagatttggc
ttggacacgtcggtgatgggaaattggtttaaacatgtgttgaaggtgagcttggagatg
actagatatgagtattatacggtggggaagtattatccgatgacggacaagtatgttccc
gataatacctcggcggatgggtggagtgggctgaggtatgactatggaaatttctatgct
tccaagtcattctatgatccgatgaagaagagaagggttttgtggggttgggctaatgaa
tctgatagtgtccaggatgatgtttccaagggatgggcgggaattcaggcgattcctagg
acggtgtggttggatcccaatggaaaacagctcttacaatggccaattatggagctcaat
aggctgagacggaagatagttatgatgctaaatcaaaagctggttaagggacaaaatgtt
gagatcaaaggaattactgcggctcaggccgatgttgaagttatctttagcttttcgagt
ttggataacgcggaggcatttgatccaagctgggttgacgcgcaagccgtgtgcagtcag
ctgggatccacggcccaaggtggtgtgggaccctttgggcttttgactctggcttcagaa
aacctcgaggagttcactcctgtgttcttcaggatcttcaaggcagaggctaatcacgtg
gttcttatgtgctctgatgcaagaagctcatctttgaaagatggattatacaagccgaca
tttgcgggtttcgtcgacatcgatttgtcgagtaaaaagctctcattaagaagcttgatt
gatcactcggtgatagagagctttggtgggggaggaaaaacatgcataacttcgagggta
tacccaacaaaggcggtgtttggggatgctcatttgcatgttttcaacaatggaacagag
tctatcacggtggagtatttaagtgcttggagtatgagaagtgcttgggtgaactaa

DBGET integrated database retrieval system