KEGG   Caulobacter mirabilis: CSW64_04600Help
Entry
CSW64_04600       CDS       T05166                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
cmb  Caulobacter mirabilis
Pathway
cmb00061  Fatty acid biosynthesis
cmb00071  Fatty acid degradation
cmb01100  Metabolic pathways
cmb01212  Fatty acid metabolism
cmb02024  Quorum sensing
Module
cmb_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:cmb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CSW64_04600
   00071 Fatty acid degradation
    CSW64_04600
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CSW64_04600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cmb01004]
    CSW64_04600
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmb04147]
    CSW64_04600
Enzymes [BR:cmb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     CSW64_04600
Lipid biosynthesis proteins [BR:cmb01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   CSW64_04600
Exosome [BR:cmb04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   CSW64_04600
  Exosomal proteins of breast cancer cells
   CSW64_04600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ATQ41738
UniProt: A0A2D2AUQ7
Position
complement(948405..949946)
Genome map
AA seq 513 aa AA seqDB search
MSAIESTPAVHAGDRRVGHAEIRERALKAAAGLRALGVREGDTVALVLRNDVAFFEAALG
ASLAGAYPVPLNWHSTAEEAGYILRDSGARAVIAHADLLPGMEAGIPAGVPVLVVDTPDE
IAAAYAAAVAPHAVPARAWDGFVDEHGPLADPSPVNRSAVIYTSGTTGKPKGVRRQPPAP
GATPPTLSGLTPFGLDRPGPIIVLMNGPMYHAAPNIYGLSALHVGADIVLQPRFDAEEML
QLIERHGITHMHIVPTMFVRLLKLPEAVKAKYDLSSLQFVVHGAAPCPPAVKRAMIDWWG
PVIFEYYGSSETGLAAFHGAEEAVAKPGTVGRPLPGVDIVIVGDDGAELPAGEVGEVYIR
PANLPDFTYIGADEKRREVGRGAHVTVGDVGYLDADGYLFLCDRKRDMVISGGVNIYPAE
IEAVLLDVSGVKDCAVFGIPDEEFGEALCAYVEPVDGATLDPVDIRAALAGRLSRYKVPR
LVEIVPALPREDSGKIFKRRLREPYWEGRGRAI
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccatcgagtccacgcccgccgttcatgccggcgaccgccgggtcggccacgcc
gagatccgcgaacgggcgctcaaggcggcggcaggcctgcgggccctgggcgtgcgcgag
ggcgatacggtggccctggtcctgcgcaacgacgtcgccttcttcgaggccgcgctgggc
gccagcctggccggcgcctatccggtgccgctgaactggcattcgaccgccgaagaggcc
ggctacatcctgcgcgacagcggcgcccgggcggtgatcgcccacgccgacctgctgccg
gggatggaagccggaatccccgcgggcgttccggtgctggtcgtcgacacgccggacgag
atcgccgccgcctacgccgccgccgtcgcgccccacgctgtcccggcccgcgcctgggac
ggcttcgtcgatgagcatggcccgctcgccgatccgtcgccggtgaaccgttcggcggtg
atctacacctccggcaccaccggcaagccgaagggcgttcgccgccaaccgccggcgccg
ggcgcgacgccgccgacgctcagcggcctgacgccgttcgggctggaccggcccggtccg
atcatcgtgctgatgaacggcccgatgtaccacgccgcgcccaacatctacggcctgagc
gccctgcacgtcggggctgacatcgtgctgcagccgcgcttcgacgccgaggagatgctg
cagctgatcgagcgccacggcatcacccacatgcacatcgtgccgaccatgttcgtgcgg
ctgctcaagctgccggaggccgtgaaggcgaagtacgacctctcctccctccagttcgtc
gtccatggcgctgcgccctgcccgccggccgtgaagcgggcgatgatcgactggtggggc
ccggtgatcttcgaatactacggctcgtcggagaccggcctggctgctttccacggcgcg
gaagaagctgtggcgaagcccggcacggtcggccgccccctgcccggcgtcgacatcgtc
atcgtcggcgacgacggcgcggagctgcctgcgggcgaggtcggcgaggtctatatccgc
ccggccaacctgcccgacttcacctacatcggggccgacgagaagcgtcgcgaagtcggg
cgcggcgcccatgtcaccgtcggcgacgtcggctacctggacgcggacggctatctgttc
ctgtgcgaccgtaagcgcgacatggtcatctccggcggggtgaacatctatccggccgag
atcgaggccgtgctgctggacgtgtccggcgtgaaggactgcgccgtgttcggcatcccg
gacgaggagttcggcgaagccctgtgcgcctatgtcgagccggtcgacggcgcgactctg
gacccggtcgacatccgcgccgccctggccgggcggctgagccgctacaaggtcccccgg
ctggtcgagatcgtcccggccctgccccgcgaggactccggcaagatcttcaagcgccgc
ctgcgcgagccctattgggaaggccgcggccgggcgatctag

DBGET integrated database retrieval system