KEGG   Caulobacter mirabilis: CSW64_06305Help
Entry
CSW64_06305       CDS       T05166                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
cmb  Caulobacter mirabilis
Pathway
cmb00780  Biotin metabolism
cmb01100  Metabolic pathways
Module
cmb_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:cmb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CSW64_06305 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cmb01007]
    CSW64_06305 (bioF)
Enzymes [BR:cmb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     CSW64_06305 (bioF)
Amino acid related enzymes [BR:cmb01007]
 Aminotransferase (transaminase)
  Class II
   CSW64_06305 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase DegT_DnrJ_EryC1 Lactamase_B_2
Motif
Other DBs
NCBI-ProteinID: ATQ42054
UniProt: A0A2D2AVM5
Position
complement(1300369..1301529)
Genome map
AA seq 386 aa AA seqDB search
MDSLDAFAGGKLAALEAKSLKRTLVPTGRTDGVHVERGGKTLISFSCNDYLGLSHHPRVK
AAAADALARWGTGSGASRLVTGDNPLIEDLETRLARLKGAEAACVFGSGYLANTGIIPTL
TGEGDLILVDELAHACLWAGSQLSPADVVMFRHNDVDHLAELLAETRAAYRHVLVVTDGV
FSMDGDLAPLDRMVPLCAAHDAWLMTDDAHGVGVVGGGRGSSYAFEATAKPPLQMGTLSK
AIGGYGGYLCANKPVIDFIKTRARTVVYSTGLPPANAAAAIAALDLIESDSVLVGEPVRK
ARLFTAALGLPPAESPIVPVLFGPAEAALTAMRALEAMGFMVVAIRPPTVPAGTARLRFT
FSALHSDADVLRLADAVRALLAKAAA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggacagcctggacgccttcgccggcggcaagctcgcggcgctggaggccaagagcctg
aagcggaccctggtcccgaccggccggaccgacggagtgcatgtcgagcgcggcggcaag
acgctgatcagcttctcctgcaacgactacctgggcctgtcgcatcatccgcgggtcaag
gccgccgccgccgacgccctggcccgctgggggaccggctcgggcgcctcgcggctggtc
accggcgacaacccgctgatcgaggatctggagacccgcctcgcccgtctgaagggcgcg
gaggccgcctgcgtgttcggctcgggctatctggccaacaccgggatcatcccgaccctg
accggcgaaggcgacctgatcctggtcgacgaactggcccacgcctgcctgtgggccgga
tcgcagctgtcgccggcggacgtggtcatgttccgccacaacgacgtcgaccatctggcc
gagttgctggccgagacgcgcgccgcctaccgccatgtgctggtggtgaccgacggggtg
ttctcgatggacggcgacctggcgccgctggaccggatggtccccctgtgcgcggcgcat
gacgcctggctgatgaccgacgacgcccatggcgtcggggtggtcggcggcgggcgcggc
tcgtcctacgccttcgaggcgacggccaagccgccgctgcagatggggaccctgtccaag
gcgatcggcggctacggcggctatctgtgcgccaacaagcccgtcatcgacttcatcaag
acccgggcccggacggtggtctactcgaccggcctgccgccggccaacgccgccgccgcg
atcgccgccctggacctgatcgaaagcgactccgtcctcgtcggcgagccggtgcgcaag
gcgcggctgttcaccgcggccctgggcctgccgccggccgagagcccgatcgtcccggtg
ctgttcggcccggccgaggcggcgctgaccgccatgcgcgcgctggaggccatgggcttc
atggtcgtggccatccgtccgccgacggtgccggccggaaccgcccgcctgcgcttcacc
ttcagcgccctgcatagcgacgccgacgtcctgcgcctggccgacgccgtgcgcgcgctg
ctggcgaaggcggcggcgtga

DBGET integrated database retrieval system