KEGG   Caulobacter mirabilis: CSW64_13735Help
Entry
CSW64_13735       CDS       T05166                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
cmb  Caulobacter mirabilis
Pathway
cmb00360  Phenylalanine metabolism
cmb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cmb00790  Folate biosynthesis
cmb01100  Metabolic pathways
cmb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cmb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CSW64_13735
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CSW64_13735
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CSW64_13735
Enzymes [BR:cmb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     CSW64_13735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ATQ43397
UniProt: A0A2D2AZP5
Position
2864996..2865862
Genome map
AA seq 288 aa AA seqDB search
MSADGFSSGPPPGAAADWTIDQGWDAYTADEHAVWDLLYERQAAMLPGRACDAFLHGLDA
LNLHRGGIPEFRRINEDLQKLTGWSVVAVPGLVPDEVFFEHLANRRFPAGQFIRRRDQLD
YLQEPDIFHDVFGHVPMLTDPVFADYMQAYGQGGMRALGLGRLHNLARLYWYTVEFGLLE
TPAGLRIYGAGIVSSRTESIFALDDPSPNRLGFDLERTMRTPYRIDDFQQVYFVIPSLQA
LLDATLEDFGALYARLDGASDIPIDRVEPTDRVFTQGTQAYAAAKLRG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagacggcttcagcagcggcccgcccccgggagcggcggcggattggacgatc
gaccaggggtgggacgcctacaccgcggacgagcacgccgtatgggacctgctctatgaa
cgtcaggccgcgatgctgcccggccgggcctgtgacgcgttcctgcacgggctggacgcg
ctgaacctgcaccgcggcggcatccccgagttccgcaggatcaacgaagatctgcagaag
ctcaccggttggagcgtcgtcgccgtgccgggcctggtgcccgacgaggtcttcttcgag
catctggccaatcggcggttcccggcgggacaattcatccgccgccgcgaccagctggac
tatctgcaggaaccggacatcttccacgatgtcttcggtcatgtgccgatgctgacggac
ccggttttcgccgactacatgcaggcctacggccaaggcggcatgcgcgccctgggcttg
ggccgcctgcacaacctcgcccgcctctactggtacacggtcgagttcggcctgctggag
actccggcgggcctgcgcatctacggcgccggcatcgtttcctcgcgcaccgagtcgatc
ttcgccctcgacgatccctcgcccaatcggctggggttcgacctggagcggaccatgcgc
accccctaccgcatcgacgacttccagcaggtctacttcgtgattccctcgctgcaggcg
ctgctcgacgcgacgctggaggacttcggcgcgctctacgcccgattggacggcgccagc
gacatcccgatcgatcgggtcgagccgaccgaccgggtgttcacgcaggggacgcaggcc
tacgccgccgccaagctgcgcggatag

DBGET integrated database retrieval system