KEGG   Caulobacter mirabilis: CSW64_15845Help
Entry
CSW64_15845       CDS       T05166                                 

Definition
(GenBank) propionyl-CoA--succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
cmb  Caulobacter mirabilis
Pathway
cmb00020  Citrate cycle (TCA cycle)
cmb00620  Pyruvate metabolism
cmb00650  Butanoate metabolism
cmb01100  Metabolic pathways
cmb01110  Biosynthesis of secondary metabolites
cmb01120  Microbial metabolism in diverse environments
cmb01130  Biosynthesis of antibiotics
cmb01200  Carbon metabolism
Module
cmb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cmb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CSW64_15845
   00620 Pyruvate metabolism
    CSW64_15845
   00650 Butanoate metabolism
    CSW64_15845
Enzymes [BR:cmb01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     CSW64_15845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans CitF
Motif
Other DBs
NCBI-ProteinID: ATQ43760
UniProt: A0A2D2B0H2
Position
3303746..3305254
Genome map
AA seq 502 aa AA seqDB search
MTRIRNAAFRSKIMSAAEAAALIPPGSTVGMSGFTGSGYPKTVPPALAARIEAEHAKGNP
FRLRVWTGASTGPELDGALAKADGIEFRLPYNSDPIARDKINKGQMEYLDMHLSQVAPVA
WQGFLGPLDAAVVEVSGVREDGTLIPSSSVGNNKTWLDRAERIILEINRWQNPALEGMHD
IYYGTALPPDRVPIPLVRPTDRIGETGFRVDPAKVVAVVETDAPDRNAPFAAPDDGAERI
AGHLIEFLQHEVKRGRLPASLLPLQSGVGNVANAVMAGLLDSPFENMTAYTEVLQDGMLA
LLDSGKLTVASATAFSLSPEAAADLNARMDAFRDKIILRPQEISNHPELIRRLGCIAMNG
LIEADIYGAVNSTHIMGSRIQNGIGGSGDFARNAFISVFMTPSTAKGGKISAIVPMASHV
DHITQDVQVIVTEQGLADLRGLSPKQRAEVIIPNCAHPDYRDALLDYHKRALMGSYGLQT
PHLLTEALSWHQRFIETGSMQP
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcatccgtaacgccgccttccgctcgaagatcatgtccgccgccgaggccgcc
gccctgatcccgccgggatcgacggtcgggatgagcggcttcaccgggtccggctatccc
aagaccgtgccgccggcgctggccgcccggatcgaggccgagcacgccaagggcaatccg
ttccggctgcgggtctggaccggcgcctcgaccggcccggaactcgacggcgccctcgcc
aaggcggacggcatcgagttccgcctgccctacaactccgaccccatcgcccgcgacaag
atcaacaagggccagatggagtatctggacatgcacctcagccaggtggcgccggtcgcc
tggcagggcttcctagggccgctcgacgcggctgtcgtcgaggtcagcggcgtccgcgag
gacggcacgctgatcccctcctcctcggtcggcaacaacaagacctggctggaccgggcc
gagcgcatcatcctggagatcaatcgctggcagaacccggcgctggaagggatgcacgac
atctactacggcaccgccctgcccccggaccgcgtgccgatccccctggtccgccccacc
gaccgcatcggggagaccggcttccgcgtcgacccggccaaggttgtcgcggtggtcgag
accgacgccccggatcgcaacgctcccttcgccgcccccgacgacggggccgagcgcatc
gccggccacctgatcgagttcctgcagcacgaagtgaagcgcggccgcctgcccgcctcc
ctcctgccgctgcagtccggcgtcggcaacgtggccaacgcggtcatggccgggctgctg
gacagccccttcgagaacatgaccgcctacaccgaggttctgcaggacggcatgctggcg
ttgctcgacagcggcaagctgaccgtcgcctcggccaccgccttctcgctgagccccgag
gccgccgccgacctcaacgcccgcatggatgcgttccgcgacaagatcatcctgcggccg
caggagatctcgaaccatccggagcttatccgccgcctgggctgcatcgccatgaacggc
ctgatcgaggccgacatctacggcgcggtgaactcgacccacatcatgggttcgcgcatc
cagaacggcatcggcggctccggcgacttcgcgcgcaacgccttcatctcggtgttcatg
acgccgtcgacggccaagggcggcaagatctcggcgatcgtgcccatggccagccacgtc
gatcacatcacccaggacgtgcaggtcatcgtgacggaacagggcctggccgacctgcgc
ggcctgtcgcccaagcagcgggccgaggtcatcatccccaactgcgcccacccggactac
cgcgacgccctgctcgattaccacaagcgcgcgctgatgggctcctacggcctgcagacc
ccgcatttgctgaccgaggccctgtcctggcaccagcggttcatcgagacgggatcgatg
cagccctga

DBGET integrated database retrieval system