KEGG   Caulobacter mirabilis: CSW64_17900Help
Entry
CSW64_17900       CDS       T05166                                 

Definition
(GenBank) beta-hexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
cmb  Caulobacter mirabilis
Pathway
cmb00511  Other glycan degradation
cmb00520  Amino sugar and nucleotide sugar metabolism
cmb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CSW64_17900
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CSW64_17900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cmb03110]
    CSW64_17900
Enzymes [BR:cmb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CSW64_17900
Chaperones and folding catalysts [BR:cmb03110]
 Intramolecular chaperones
  Others
   CSW64_17900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b CHB_HEX_C_1 Fn3_assoc CHB_HEX_C CBM_6
Motif
Other DBs
NCBI-ProteinID: ATQ44127
UniProt: A0A2D2B1P7
Position
complement(3788033..3790363)
Genome map
AA seq 776 aa AA seqDB search
MPSSLPSAPWRGVFLAACAAVLSAAFPASAETSSLALTPAPRLVEQAAGAFPLDRGVEIV
VPDGDAGARNAASFLAGLIARSHGFTPDIREGAAGARPAIVFETSQVSGPEAYALTVGPD
RAVIQASGDGGRLYGATTFWQLATQAPGARTVPAVRVEDAPRFGWRGLMLDSARHFQSVE
FIKRFIDQMAVYKLNVLHWHLTDDQGWRLEIRKYPRLTGAGACRVPAGEAQKDIDPATGR
PREYCGYYTQDQVREIVAYAAARNITIVPEIDMPGHAQAALVAYPEIGAALTPPKTVEAD
WGVFPYLFGVDDTAMGFARDVLDEVVELFPSPYIHVGGDEAVKDQWKANPAVQARMKALG
VKDEHALQSWFIHELELHLKARGRRLIGWDEILEGGLAPDATVMSWRGLDGAVAAARMGH
DTVLSPQPMLYLNHRQSGAPEEQPGRGKVVTLKEVYAFDPAPSQMTVDERRHVLGVQATL
WTEHMRTEDRVWRSAWPRAAAVAEAGWSDEGRRSWAGFSARLPVETARLALLGNPFDILA
LEPTLVADRAGRRVRVGLGVPAGAGEIRYTTDGSTPTAKSPLYGEPITVPLDATVQARTF
VDGRPLGEARRWTADARLAGTRYSGQLAMCSDKLNLALEDDAPLRGERAVFLIDILEPCW
RWNAADLTGVSRIEVAVGQLPFNFQIGKDIEKITFRPPATPAGELEVRAGGCKGERIGVL
PLAPAVDNPAVTVLTGAIASRSGKQDLCFTFTQRGVEPMWAIDRVTLVPGAMAGGK
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgagccttccttcggcgccctggcggggcgtcttcctggccgcctgcgcggcg
gtcctgagcgccgctttcccggcctcggccgagacctcatcccttgccctgacgcccgcg
ccgcggctggtcgaacaggccgccggcgcctttccgctcgatcgcggcgtcgagatcgtc
gttccggatggcgacgcgggcgcgcgaaacgcggcgtcctttctcgcgggcctgatcgca
cggagtcacggcttcacgccggatatccgcgaaggcgcggcgggcgcgcgtccggccatc
gtcttcgagacgagccaagtctctggccccgaagcctatgctctgacagtgggcccagac
cgggcggtgatccaagcttcgggcgatggcggccggctgtacggcgccacgaccttctgg
cagctggcgacccaggcgccgggcgccaggaccgttcccgcggttcgcgtggaggacgcg
cccagattcggctggcgcgggctgatgctggattcggctcgccatttccagagcgtggaa
ttcatcaagcggttcatcgaccagatggccgtctacaagctgaacgttcttcactggcac
ctgacggatgaccagggctggcgcctggagatccgcaagtatccgcgcctgaccggggcc
ggcgcctgtcgcgtcccggctggcgaggcgcagaaggacatcgaccccgcgaccggccgg
ccgcgcgagtactgcggctactacacgcaggatcaggtccgcgagatcgtcgcctacgcc
gcggcgcgcaacatcaccatcgtgcccgagatcgacatgccgggtcacgcccaggccgct
ctggtcgcttatcccgaaatcggcgcggctctgacgccgccgaagacggtcgaggccgac
tggggcgttttcccctacctgtttggcgtcgacgacacggcgatgggcttcgcccgcgat
gtgcttgacgaagtcgtggagctgttcccgagcccctacattcacgtcggcggggatgag
gcggtcaaggatcagtggaaggccaatccggccgttcaggcgcggatgaaggcgttgggc
gtcaaggacgaacatgcgctgcagtcctggttcatccacgagctcgagctgcatctgaag
gcgcgcggccggcgtctgatcggctgggacgagatcctcgaaggcggcttggcgccggac
gcgacggtgatgtcgtggcgcgggttggacggcgccgtcgccgcggcccggatgggccac
gacaccgtcctttcgccgcagccgatgctctatctgaaccatcgccaaagcggcgcgccg
gaggagcagcctggccgcggcaaggtggtgacgctgaaagaggtctacgccttcgacccc
gcgccgtcgcagatgacggtcgatgagcggcggcacgtgcttggcgtccaggcgacgctc
tggaccgaacatatgcgcaccgaggatcgggtctggcgctcggcctggccgcgcgcggcc
gccgtggccgaagccggttggagtgatgaggggcgccgcagttgggccggattcagcgcc
cgcctgccggtcgagacggcgcggttggcgctgctcggcaatccgttcgacatcctggct
ctggagccgacgctggtcgctgaccgcgcagggcggcgggtccgagtggggctcggcgtt
cccgccggcgccggcgagatccgctacacgaccgacggatcgactccgacggcgaagtcg
ccgctgtatggcgagcccatcacggttccgctggatgcgacggtgcaggcgcggaccttc
gtcgacgggcgaccgctcggcgaagcgcggcgttggacggccgacgcccggctggccgga
acccgttacagcgggcagctggcgatgtgttccgacaagttgaatctggcgctggaggac
gacgcccccctgcgcggcgaacgggcggtgttcctgatcgacatcctggagccctgctgg
cgttggaacgccgccgatctgaccggcgtctcgcgcatcgaggtcgcggtcggacagctg
ccgttcaacttccagatcggcaaggatatcgagaagatcaccttccgcccgccggcgacc
ccggccggagaactcgaggtgcgggctggcggctgcaagggcgagcggatcggcgttctg
cctctggctcccgcggtcgacaatccggccgtcaccgtcctgaccggcgcgatcgcatcg
cgaagcggcaagcaggatctctgcttcaccttcacccagcggggcgtcgagccgatgtgg
gcgatcgatcgcgtcaccctcgttcccggcgcgatggccggcgggaagtag

DBGET integrated database retrieval system