KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_00407Help
Entry
CMN_00407         CDS       T02530                                 

Gene name
pitA
Definition
(GenBank) low affinity phosphate permease, transporter family 2.A.20
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Brite
KEGG Orthology (KO) [BR:cmc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CMN_00407 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CCE74375
UniProt: M5B827
Position
405896..407113
Genome map
AA seq 405 aa AA seqDB search
MDPFILLVLVVITALAFDFTNGFHDTANAMATSIATGALKPKVAVTLSAVLNLVGAFLSI
EVALTVTNAVVKIQDKSGAPDPALLQGGGSALLLIVLAGLIGGIVWNLLTWLLGLPSSSS
HALFGGLIGSTLAGLGLNGVNWAGDGSKLDGVVGKVILPALMSPILAGAVAAVGTWLVFR
IVGNLAGRGLDRTFRIGQIGSASLVSLAHGTNDAQKTMGVITLALIAAGGWTDTESVPFW
VKISCALAISLGTYIGGWRIIRTVGKGLVEIDTHQGMAAESSSAAVILASSHLGFALSTT
HVATGSILGSGVGRPGAQVRWRVALRMVVAWIITLPAAALVGAVMWWLGHLIGGAAGGIA
MTLVLVAVSITVYVRSRKDDVGAHNVNDEWSDEKAARPAPQPADA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtggatcccttcattctcctcgtgctcgtcgtcatcacggcgctcgccttcgacttcacc
aacggcttccacgacacggcgaacgcgatggccacatccatcgcgaccggcgcgttgaag
cccaaggtcgcggtcacgctctccgccgtgctcaacctggtgggcgccttcctcagcatc
gaggtcgcgctcacggtcacgaacgcggtcgtgaagatccaggacaagtcgggcgccccc
gacccggcgctgctgcagggcggcggatccgcgctgctgctcatcgtgctcgcgggcctc
atcggcggcatcgtgtggaacctgctcacctggctgctcggcctcccgtcgagctcctcg
cacgcgctgttcggcggcctcatcggctcgacgctcgcgggcctcgggctgaacggcgtg
aactgggcgggcgacggatccaagctcgacggcgtcgtgggcaaggtgatcctgccggcg
ctcatgtcgccgatcctcgcgggggcggtggccgccgtcggcacgtggctggtcttccgc
atcgtcggcaacctcgccggccgcggcctcgaccgcaccttccgcatcggccagatcggc
agcgcctcgctcgtctccctcgcgcacggcacgaacgacgcgcagaagaccatgggcgtc
atcacgctcgcgctcatcgcggcgggcggctggaccgacacggagtcggtgccgttctgg
gtgaagatcagctgcgcgctcgccatctcgctcggcacctacatcggcggctggcgcatc
atccgcacggtcggcaagggtctcgtcgagatcgacacgcaccagggcatggccgccgag
agctcgtcggccgcggtcatcctcgcgtccagccacctcggcttcgcgctctccaccacg
cacgtcgccaccgggtccatcctcggctccggcgtcggccggcccggcgcgcaggtgcgc
tggcgcgtggcgctgcgcatggtcgtggcgtggatcatcaccctcccggccgccgccctc
gtcggcgcggtcatgtggtggctcggccacctcatcggcggagcggccggcggcatcgcg
atgacgctcgtgctcgtcgccgtctcgatcaccgtctacgtccgctcgcgcaaggacgac
gtgggcgcgcacaacgtgaacgacgagtggtccgacgagaaggccgcccgccccgccccc
cagcccgccgacgcctga

DBGET integrated database retrieval system