KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_00688Help
Entry
CMN_00688         CDS       T02530                                 

Definition
(GenBank) putative methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
cmc00450  Selenocompound metabolism
cmc00970  Aminoacyl-tRNA biosynthesis
cmc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CMN_00688
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CMN_00688
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cmc01007]
    CMN_00688
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cmc03016]
    CMN_00688
Enzymes [BR:cmc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CMN_00688
Amino acid related enzymes [BR:cmc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CMN_00688
Transfer RNA biogenesis [BR:cmc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CMN_00688
 Prokaryotic type
   Other AARSs
    CMN_00688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g DZR zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: CCE74647
UniProt: M5B717
Position
complement(669182..670423)
Genome map
AA seq 413 aa AA seqDB search
MGPGAVITVPPASAHSYDHAGWATDLVVAGALGAILGGGPGGRAPAVVATRDEHSIPALA
GGPPPPLAHLGALARSVAGGDVVVGSTAQPAVADYARAAWDALAARGALERGVHARPRCS
RCGALPDASATSACAGCGSPAPPGDGEPNWFLRVAPFAEGIAAFRARVDLRGPAAALGRA
SAAPPATLSVSRSASRTGGHGVPVPGDPGQVIHSGFVAAASYLAPRPDAGWAEAATRIQV
LGKGLLNLHLTLVPLLCQALDAPTADVLHVHHHLRVEGRSPREAAAAGITASALVERHGP
TAVRWGILRLALARRDASLLLRDLAALGSREAPRVAALAGCAGPDADAMPGPDADPAAGR
RTAAQLAALDLGGLTRSLLAAPDRGGLDAVAAGTDRARLDALVAWVVGAGARA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggggccgggcgccgtcatcaccgtcccgcccgcgtccgcgcactcctacgaccacgcg
ggctgggcgacggacctcgtcgtcgcgggggccctcggggcgatcctcggcgggggcccg
gggggccgggcccccgcggtggtcgccacgcgcgacgagcacagcatccccgcgctcgcg
ggcggaccgcctccgccgctcgcgcacctcggggccctcgcgcggtccgtggccggcggg
gacgtcgtcgtgggatccacggcgcagcccgcggtcgccgactacgcccgtgccgcgtgg
gacgcgctcgcggcgcggggcgcgctcgagcgcggggtgcacgcccggccccgatgctcc
cggtgcggggccctgccggacgcctccgccacctccgcctgcgcggggtgcgggagcccg
gcgcccccgggcgacggcgagccgaactggttcctccgcgtcgcgccgttcgccgagggg
atcgccgcgttccgcgcgcgcgtcgacctccggggcccggccgcggccctcgggcgcgcg
agcgcggccccgcccgcgacgctcagcgtctcgcggtcggcgtcccgcacgggcgggcac
ggcgtgcccgtgccgggcgaccccggacaggtgatccactcggggttcgtggcggcggcg
agctacctggcgccgcggcccgacgcggggtgggcggaggcggcgacgcggatccaggtg
ctcggcaagggcctgctcaacctgcacctcaccctcgtgccgctcctgtgccaggcgctc
gacgcgccgaccgccgacgtgctccacgtgcaccaccacctgcgcgtggaggggcggtcc
ccgcgggaggcggcggccgcggggatcaccgcgtcggcgctcgtcgagcggcacgggccg
accgcggtgcgctgggggatcctgcgcctcgcgctggcccgccgcgacgcgtcgctgctg
ctccgcgacctcgcggcgctcgggtcccgggaggcgccgcgcgtggccgcgctggccgga
tgcgcgggcccggacgcggacgcgatgcccgggcccgacgcggaccccgccgccgggcgg
cggacggcggcgcagctcgcggccctcgacctcggcgggctcacccggtcgctgctcgcc
gcgccggaccgcggcgggctcgacgccgtggccgcgggaaccgaccgcgcgcggctcgac
gccctcgtcgcctgggtcgtcggcgcgggggcccgcgcgtga

DBGET integrated database retrieval system