KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_01858Help
Entry
CMN_01858         CDS       T02530                                 

Gene name
pycA
Definition
(GenBank) Cmm ortholog CMM_1880; Cms ortholog CMS_1351
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
cmc00020  Citrate cycle (TCA cycle)
cmc00620  Pyruvate metabolism
cmc01100  Metabolic pathways
cmc01120  Microbial metabolism in diverse environments
cmc01200  Carbon metabolism
cmc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CMN_01858 (pycA)
   00620 Pyruvate metabolism
    CMN_01858 (pycA)
Enzymes [BR:cmc01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     CMN_01858 (pycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 Dala_Dala_lig_C HlyD_3 HlyD_D23 ATP-grasp RnfC_N GCV_H NQRA
Motif
Other DBs
NCBI-ProteinID: CCE75803
UniProt: M5B9J9
Position
complement(1955530..1958931)
Genome map
AA seq 1133 aa AA seqDB search
MFEKILVANRGEIAIRAFRAAVELGARTVAVYPHEDRHSLHRLKADEAYLIGEEGHPVRA
YLDVDEIIRVAKESGADAIYPGYGFLSENPDLARAAAANGIVFIGPDAGVLEMAGNKVTA
KEHATAAGVPVLASTPPSTDVDLLLEQAAGIGFPIFAKAVAGGGGRGMRRVERAEDLEDA
LRAAMREADSAFGDPTMFLEQAVLRPRHIEVQILADATGETVHLFERDCSVQRRHQKVVE
IAPAPNLDPAIRDAMHAHAIAFARSIGYVNAGTVEFLLDTDGPRAGQHVFIEMNPRIQVE
HTVTEEVTDIDLVQAQMRIAAGETLAELGLRQDAIALRGAALQCRITTEDLAQGFRPDTG
KITTYRSPGGGGIRIDGGTVATGAQISPHFDSMLAKLTCRGRDFPTAVTRAKRALAEFRI
RGVSTNIPFLQGVLDDPDFQAGDISTSFIDERPGLVRSNVSKDRGTKILNWLADVTVNQP
NGPRTAVVRPADKLPDADLRLPAPAGSRQRLLELGPLGFAEALRAQTALAVTETTFRDAH
QSLLATRVRTRDLVAVAPYVARTTPELLSVEAWGGATYDVALRFLGEDPWERLASLREAL
PNVAIQMLLRGANTVGYTPYPTAVTDAFVQESAATGVDVFRIFDALNDVERMRPAIDSVL
ATGTTVAEVALCYTGNLLDPAEDLYTLDYYLRLAERSVAAGAHVLAIKDMAGLLRPAAAE
RLVTALRREFDLPVHVHTHDTAGGQLATLLAASRAGADAVDVASAPMSGTTSQPSASALV
AALADTERDTGLSLDAVSDLEPYWEAVRRLYRPFESGLAGPTGRVYRHEIPGGQLSNLRQ
QAIALGLADDFELIEDMYQAADRILGRIPKVTPSSKVVGDLALQLAAAKADPADFERNPQ
DYDIPDSVVGFMAGELGDLPGGWPEPFRTRVLQGRDVRIGVTPLFAEDRAALELPGAERR
RALNRLLFPQPTEQFETIRELFGDLSVLDTDDYLHGLRPGQEHAVRISRGVEVLIALEAV
GDADESGMRTVMVVMNGQLRPVFVRDRGIAVTTTVAERGDPANPGHVSAPFSGVVTLKVE
EGQVVAAGQPVASIEAMKMEAAITSPVAGRVARLAVPTTQQVDAGDLLVIVEP
NT seq 3402 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagaagatcctggtcgccaaccgcggggagatcgcgatccgcgcgttccgcgcc
gccgtcgagctgggcgcccgcacggtggccgtctacccgcacgaggaccggcactcgctg
caccgcctcaaggcggacgaggcctacctgatcggcgaggaggggcaccccgtccgggcg
tacctcgacgtcgacgagatcatccgcgtggcgaaggagtcgggtgccgacgcgatctac
ccggggtacggcttcctctccgagaaccccgacctcgcgcgtgccgcggccgcgaacggc
atcgtcttcatcggccccgacgccggcgtgctcgagatggcgggcaacaaggtcacggcg
aaggagcacgcgaccgcggccggggtgccggtcctcgcctcgacgccgccgtccaccgac
gtcgacctgctgctcgagcaggccgcgggcatcgggttcccgatcttcgcgaaggccgtc
gcgggcggcggcggccgcggcatgcggcgcgtcgagcgcgcggaggacctcgaggacgcg
ctccgggccgcgatgcgcgaggccgacagcgccttcggcgatccgaccatgttccttgag
caggccgtgctccggccgcggcacatcgaggtgcagatcctcgccgacgccacgggggag
accgtgcacctcttcgagcgcgactgctcggtgcagcggcggcaccagaaggtcgtggag
atcgcccccgcgccgaacctcgaccccgcgatccgcgacgccatgcacgcgcacgcgatc
gccttcgcccggagcatcggctacgtcaacgccgggacggtcgagttcctgctggacacg
gacgggccgcgggcgggacagcacgtcttcatcgagatgaacccgcggatccaggtcgag
cacaccgtgacggaggaggtgaccgacatcgacctcgtgcaggcgcagatgcgcatcgcg
gcgggggagaccctcgcggagctgggcctccgccaggacgcgatcgcgttgcgcggcgcg
gcgctccagtgccgcatcacgacggaggacctggcccagggcttccgcccggatacaggc
aagatcacgacgtaccggtcgccgggcggtggcgggatccgcatcgacggcggcacggtc
gccacgggcgcgcagatcagcccccacttcgactcgatgctcgcgaagctcacgtgccgc
gggcgcgacttcccgaccgccgtcacgcgcgccaagcgggccctcgccgagttccggatc
cgtggcgtctccacgaacatcccgttcctccagggcgtgctcgacgaccccgacttccag
gcgggcgacatcagcacgtccttcatcgacgagcggccgggcctcgtgcgcagcaacgtg
tcgaaggaccgcgggacgaagatcctcaactggctggccgacgtcaccgtcaaccagccg
aacggtccccgcaccgcggtcgtccggcccgccgacaagctgcccgacgccgacctccgg
ctgccggcgcccgcgggatcccgccagcgcctcctcgagctcggcccgctcggcttcgcc
gaggcccttcgcgcgcagaccgccctcgccgtcacggagacgacgttccgcgacgctcac
cagtcgctgctggccacgcgcgtgcgcacgcgcgacctcgtcgcggtcgccccgtacgtc
gcgcgcacgacgcccgagctgctctcggtcgaggcgtggggcggggccacctacgacgtc
gcgctccgcttcctcggcgaggacccgtgggagcggctcgcgtcgctccgcgaggcgctg
ccgaacgtcgcgatccagatgctgctgcgcggcgccaacaccgtcggctacacgccgtac
cccaccgcggtcacagacgcgttcgtgcaggagtcggccgccaccggcgtcgacgtcttc
cgcatcttcgacgcgctcaacgacgtcgaacggatgcggccggccatcgactccgtgctc
gccaccggcaccactgtcgccgaggtcgcgctctgctacacgggcaacctgctggatccc
gccgaggacctctacacgctcgactactacctgcggctcgcggagcgcagcgtggccgcc
ggcgcgcacgtcctcgcgatcaaggacatggccgggctcctccgccccgccgcggccgag
cgcctcgtcaccgcgttgcgccgcgagttcgacctgccggtgcacgtgcacacgcacgac
accgcgggcggccagctcgcgaccttgctcgcagccagccgcgccggcgccgacgcggtc
gacgtggcgagcgcgcccatgtcgggcacgacgagccagccgtcggcgtccgcgctcgtc
gcggccctcgcggacaccgagcgcgacacgggcctctcgctcgacgcggtcagcgacctc
gagccctattgggaggcggtccgccgcctctaccggccgttcgagtccgggttggccggc
ccgaccgggcgtgtgtaccggcacgagatccccggcggccagctctcgaacctgcggcag
caggccatcgcgctcggcctcgccgacgacttcgagctcatcgaggacatgtaccaggcg
gccgaccggatcctcggccgcatcccgaaggtcacgccgtcgtccaaggtggtcggcgac
ctcgccctccagctcgcggccgcaaaggccgacccggccgacttcgagcggaacccgcag
gactacgacatccccgactcggtggtcggcttcatggcgggcgagctcggcgatctgccc
ggcggctggcccgagcccttccgcacgcgcgtgctccagggccgggacgtgcggatcggc
gtcactccgctgttcgccgaggaccgcgccgcgctcgagctgccgggcgccgagcgacgc
cgcgcgctcaaccgcctgctcttcccgcagccgaccgagcagttcgagaccatccgggag
ctgttcggcgacctctccgtgctcgacacggacgactacctgcacggcctccgcccgggc
caggagcacgcggtgcggatcagccggggcgtcgaggtcctcatcgcgctggaggccgtc
ggcgacgccgacgagtcgggcatgcgcaccgtcatggtcgtcatgaacgggcagctccgt
ccggtgttcgtgcgcgaccgcggcatcgccgtcaccacgaccgtggccgagcgcggggac
ccggcgaaccccggccacgtgtcggcgccgttctccggggtcgtgaccctcaaggtcgag
gagggccaggtcgtcgccgccggccagccggtcgcgtccatcgaggcgatgaagatggag
gcggccatcacgtcgcccgtcgcgggccgcgtcgcgcgcctcgcggtccccacaacccag
caggtcgacgcgggcgacctgctcgtgatcgtagagccctag

DBGET integrated database retrieval system