KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_01901Help
Entry
CMN_01901         CDS       T02530                                 

Gene name
ggtA
Definition
(GenBank) Cmm ortholog CMM_1923; Cms ortholog CMS_1306
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
cmc00430  Taurine and hypotaurine metabolism
cmc00460  Cyanoamino acid metabolism
cmc00480  Glutathione metabolism
cmc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CMN_01901 (ggtA)
   00460 Cyanoamino acid metabolism
    CMN_01901 (ggtA)
   00480 Glutathione metabolism
    CMN_01901 (ggtA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cmc01002]
    CMN_01901 (ggtA)
Enzymes [BR:cmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     CMN_01901 (ggtA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     CMN_01901 (ggtA)
Peptidases and inhibitors [BR:cmc01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   CMN_01901 (ggtA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: CCE75846
UniProt: M5B9Q1
Position
complement(1999330..2001141)
Genome map
AA seq 603 aa AA seqDB search
MTFRAPDAFTTRPTLRGTFGMSASTHWLASGTGQAVLERGGNAFDAAVASAFVLHVVEPH
LNGPGGDMTAVVHVAGEDAPKLLMGQGSAPAAATPERFRAEGLDRVPGAGALAAAVPAAV
DAWLLLLKDHGTWELADVWAFAIGYARDGHPVLESVRRTIAGVGDLFREHWSASAAFWMP
DGEAPVAGSLVRNPAWGAAMERILAEAWTAAGPDATREQRIEAARTVWAEGFVAEEMVAS
VQDPHRHSTGADHAGLLTAEDLAASRASWEDAVSIEFRGLRIWKTDAWGQGPALLQALAI
LDGFTDEEIDPATAAGIHRIIEAQKLALADREAYYGDAVPGGAPLDVLLSPGYAAERCAL
IADEASHELRPGHVDGVEPFLPPLVVEGDAPASAGGTGEPTVSRSGETRGDTCHLDIVDR
FGNMISATPSGGWLQSSPFIPSLGFCLGTRLQMTWLEPGGPSSLVPGRRPRTTLTPTLIT
RDGEPVEALGSPGGDQQDQWQLPYLLRTIVGGFSPQQAVDAPTFHTTSVPGSFWPRTWTP
GGLVVEGRVGDDVIADLRARGHEVEVVGDWTLGRLSAVTRDPATGLLGAAANPRGAQGYA
VGR
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
gtgacgttccgcgcgcccgacgcattcaccacccgacccacgctccgcggcacgttcggc
atgagcgcctccacgcactggctcgcgtccggcaccggccaggccgtgctcgagcgcggc
ggcaacgcgttcgacgccgcggtcgccagcgcgttcgtgctgcacgtcgtcgagccgcac
ctcaacggccccggcggcgacatgacggccgtcgtgcacgtcgcgggcgaggacgcgccg
aagctgctcatggggcagggatccgcgcccgccgccgcgacgcccgagcgcttccgcgcc
gagggcctcgaccgcgtgcccggcgccggcgcgctcgccgcggccgtgcccgccgccgtc
gacgcgtggctgctcctgctgaaggaccacggcacatgggagctcgccgacgtgtgggcg
ttcgcgatcgggtacgcgcgcgacgggcaccccgtgctcgagagcgtgcgtcgcaccatc
gcgggcgtcggcgacctcttccgcgagcactggtccgcgtcggcggcgttctggatgccg
gacggcgaggcgcccgtcgcggggtcgctcgtgcgcaacccggcgtggggggcggcgatg
gagcggatcctcgccgaggcgtggaccgccgccggcccggacgcgacgcgggagcagcgg
atcgaggccgcccgcaccgtctgggcggagggcttcgtcgcggaggagatggtcgcgagc
gtgcaggacccgcaccggcactcgaccggcgccgaccacgcggggctcctcaccgccgag
gacctcgccgcctcccgcgcgtcctgggaggacgcggtgtcgatcgagttccgcggcctc
cggatctggaagaccgacgcctggggccagggcccggcgctgctgcaggcgctcgcgatc
ctcgacgggttcacggacgaggagatcgacccggcgaccgctgccgggatccatcgcatc
atcgaggcgcagaagctcgcgctggccgaccgcgaggcgtactacggcgacgcggtgccg
ggcggcgcgcccctcgacgtgctgctgtctcccgggtacgcggccgagcggtgcgcgctc
atcgccgacgaggcgtcgcacgagctgcggcccgggcacgtcgacggcgtcgagcccttc
ctgccccctctcgtggtcgagggcgacgcgcccgcgtccgccggcggcacgggcgagccc
accgtctcccgcagcggcgagacccgcggcgacacctgccacctcgacatcgtcgaccgc
ttcggcaacatgatctccgccacgccctccggcggctggctccagtcgtcgccgttcatc
ccgtcgctcggtttctgcctcggcacgcgcctgcagatgacgtggctcgagcccggcggc
ccgtcgtcgctcgtgcccggccgtcgcccgcggacgacgctgacgcccacgctgatcacg
cgcgacggcgagcctgtcgaggcgcttggctcgcccggcggcgaccagcaggaccagtgg
cagctgccctacctgctgcgcacgatcgtcggcggcttcagcccgcagcaggcggtcgac
gcgccgacgttccacacgacgagcgtccccggatcgttctggccgcgcacctggacgccc
ggcgggctcgtggtcgagggccgcgtgggcgacgacgtcatcgcggatctccgtgcccgc
ggccacgaggtggaggtggtcggcgactggacgctggggcggctctcggccgtgacgcgg
gatcccgccacgggcctgctcggcgccgcggccaacccgcgcggggcgcaggggtacgcg
gtcgggcgatga

DBGET integrated database retrieval system