KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_02217Help
Entry
CMN_02217         CDS       T02530                                 

Definition
(GenBank) mycothiol conjugate amidase
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Brite
KEGG Orthology (KO) [BR:cmc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CMN_02217
Enzymes [BR:cmc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     CMN_02217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: CCE76155
UniProt: M5BBZ1
Position
complement(2343235..2344158)
Genome map
AA seq 307 aa AA seqDB search
MTLRLMAVHAHPDDESSKGAATYTHYTQQGAEIMVVSCTGGEAGDILNEGLAERAMAERD
LPGLRRIEMARAQAVMGVQHRWLGYVDSGMAREDGSLPPASFASIPVEVSAEPLIRLVRE
FRPHVLVAYDENGGYPHPDHIQAHVIAMEAWRESGVAGSYPDAGEPWEIAKLYFDRIFNG
AKLRAVREHLVATDAGPEMLEAVDEMLGWMGDRPDLATTHVHVADHFEARDRALLSHASQ
VAPDSTFFRWPRDLQQRAWPFEDFQLVESRVPVPEPEDDLFAGIADDVSGADVSGGDVSG
ADRAAVA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctgcgcctcatggccgtgcacgcccaccccgacgacgagtccagcaagggcgcg
gcgacctacacccactacacgcagcagggcgccgagatcatggtcgtcagctgcacgggc
ggcgaggcgggcgacatcctcaacgagggcctcgccgagcgcgcgatggccgagcgcgac
ctgccgggcctccgccgcatcgagatggcgcgcgcccaggccgtcatgggcgtgcagcac
cgctggctcggctacgtcgactcgggcatggcgcgcgaggacggctcgctgccgcccgcg
tccttcgcgagcatcccggtggaggtgtcggccgagccgctgatccgcctggtgcgcgag
ttccgcccgcacgtcctcgtggcgtacgacgagaacggcggctacccgcaccccgaccac
atccaggcgcacgtgatcgcgatggaggcgtggcgcgagtccggcgtcgccggctcctac
cccgacgcgggcgagccgtgggagatcgccaagctctacttcgaccggatcttcaacggc
gcgaagctccgcgccgtgcgcgagcacctggtcgccaccgatgccggtcccgagatgctc
gaggccgtcgacgagatgctcggctggatgggcgaccgccccgacctcgccaccacgcac
gtgcacgtggccgaccacttcgaggcccgcgaccgcgcgctcctctcccacgcgagccag
gtcgcgcccgacagcaccttcttccgctggccgcgcgacctgcagcagcgcgcctggccg
ttcgaggacttccagctcgtcgagtcgcgcgtgcccgtgcccgagccggaggacgacctg
ttcgccggcatcgcggacgacgtgtccggcgcggacgtgtccggcggcgacgtgtccggc
gctgaccgggcggctgtcgcgtga

DBGET integrated database retrieval system