KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_02247Help
Entry
CMN_02247         CDS       T02530                                 

Gene name
gndA2
Definition
(GenBank) phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
cmc00030  Pentose phosphate pathway
cmc00480  Glutathione metabolism
cmc01100  Metabolic pathways
cmc01110  Biosynthesis of secondary metabolites
cmc01120  Microbial metabolism in diverse environments
cmc01130  Biosynthesis of antibiotics
cmc01200  Carbon metabolism
Module
cmc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cmc_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CMN_02247 (gndA2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CMN_02247 (gndA2)
Enzymes [BR:cmc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     CMN_02247 (gndA2)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     CMN_02247 (gndA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 Shikimate_DH 3HCDH_N F420_oxidored 2-Hacid_dh_C NAD_binding_11 Mannitol_dh
Motif
Other DBs
NCBI-ProteinID: CCE76185
UniProt: M5BC04
Position
2381766..2383220
Genome map
AA seq 484 aa AA seqDB search
MSDDQQATANIGVVGLAVMGSNLARNLASREGNTVAVYNRTTQKTTDLVEEHPEAGFVAA
TTIEEFAASLQRPRTAIIMVKAGRGTDAVIEQLTEAFEEGDIIVDGGNALFTDTIRREKE
VRAKGLHFVGAGISGGEEGALKGPSIMPGGTAEAYETLGPILESIAAVAEGKPCVTHIGT
DGAGHFVKMIHNGIEYADMQLIAESFDLLRRVGGHEPDAIADVFEEWNGGDLESYLIAIT
AEVLRQTDAATGKPLVDVIVDQAGSKGTGVWTVQNSVGLGVPVGGIAEAVFARAVSSKPE
QRKAVQATITSRPEIQPGGDTFEDDVRAALYASKVVAYAQGFDAIIAGAKEYGWHIDKGK
VAEIWRGGCIIRAQFLNRIVGAYEKDSGLATLLEDPYFAKAVADGEQAWRRVVSVAALSG
IPVPGFASALSYYDSLASERLPAALVQGQRDFFGAHTYHRTDKEGTFHTLWSGDRSEVEA
EDTH
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgaccagcaggccacggcgaacatcggggtggtggggctcgcggtgatgggg
tcgaacctcgcccgcaatctcgccagccgcgagggcaacacggtcgcggtgtacaaccgc
acgacccagaagaccaccgacctcgtcgaggagcaccccgaggcgggcttcgtcgccgcc
accacgatcgaggagttcgccgcctcgctgcagcgtccccgcaccgcgatcatcatggtc
aaggccgggcgcggcacggacgccgtcatcgagcagctgaccgaggcgttcgaggagggc
gacatcatcgtcgacggcggcaacgcgctgttcaccgacacgatccgccgcgagaaggag
gtccgcgcgaagggcctccacttcgtcggcgccggcatctccggcggcgaggagggcgcg
ctcaagggcccgagcatcatgcccggcggcaccgcggaggcgtacgagacgctcggcccc
atcctcgagtcgatcgccgcggtcgcggagggcaagccctgcgtgacccacatcggcaca
gacggcgccggccacttcgtaaagatgatccacaacggcatcgagtacgccgacatgcag
ctcatcgccgagtcgttcgacctgctgcgccgcgtcggcggccacgagccggacgccatc
gcggacgtgttcgaggagtggaacgggggcgacctcgagtcgtacctcatcgcgatcacg
gccgaggtgctccgccagacggacgccgccacgggcaagccgctcgtcgacgtcatcgtc
gaccaggccgggtccaagggcacgggtgtctggaccgtccagaactcggtgggcctcggc
gtgccggtgggcgggatcgcggaggccgtgttcgcgcgcgccgtgtcctcgaagcccgag
cagcggaaggccgtgcaggccaccatcacgagccggccggagatccagcccggcggcgac
accttcgaggacgacgtgcgcgccgcgctctacgcgagcaaggtcgtcgcgtacgcgcag
ggcttcgacgcgatcatcgccggcgcgaaggagtacggctggcacatcgacaagggcaag
gtcgcggagatctggcgcggcggctgcatcatccgcgcccagttcctcaaccgcatcgtc
ggggcgtacgagaaggactccggcctcgcgacgctcctcgaggacccgtacttcgccaag
gccgtcgccgacggcgagcaggcctggcgccgggtcgtctcagtcgccgcgctgtcgggg
atcccggtgcccggcttcgcgtcggcgctgagctactacgactcgctcgcctccgagcgc
ctgcccgccgccctcgtgcagggccagcgcgacttcttcggcgcgcacacgtatcaccgc
accgacaaggagggcaccttccacacgctgtggtccggcgaccgctccgaggtagaggcg
gaggacacgcactag

DBGET integrated database retrieval system