KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_02568Help
Entry
CMN_02568         CDS       T02530                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
cmc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cmc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CMN_02568 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cmc03011]
    CMN_02568 (rplV)
Ribosome [BR:cmc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CMN_02568 (rplV)
  Bacteria
    CMN_02568 (rplV)
  Archaea
    CMN_02568 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CCE76502
UniProt: M5BDW5
Position
complement(2714499..2714891)
Genome map
AA seq 130 aa AA seqDB search
MVESIARVRHIRVTPQKARRVVDMIRGKQAEEALAILKFAPQGASEPIYKLVASAMANAR
VKADASNSFLAEQDLYIAKAFVDEGTTLKRFQPRAQGRAFRINKRTSHITVVLATPDEVD
VATTTKKASK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggtggagtcgatcgcacgcgtgcgtcacatccgcgtcaccccccagaaggcccgtcgc
gtcgtggacatgatccgtggcaagcaggccgaggaggccctggccatcctgaagttcgcg
ccgcagggcgcgagcgagccgatctacaagctggtggcctcggccatggcgaacgcgcgg
gtcaaggccgacgcgtccaacagcttcctcgcggagcaggacctctacatcgccaaggcg
ttcgtggacgagggcaccaccctcaagcggttccagccccgcgcacagggtcgcgcattc
cgtatcaacaagcgcaccagccacatcacggtcgtcctcgcgacgccggatgaggtggac
gtggcgacgaccacgaagaaggcgagcaagtaa

DBGET integrated database retrieval system