KEGG   Corynebacterium maris: B841_00720Help
Entry
B841_00720        CDS       T02784                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cmd  Corynebacterium maris
Pathway
cmd00071  Fatty acid degradation
cmd00072  Synthesis and degradation of ketone bodies
cmd00280  Valine, leucine and isoleucine degradation
cmd00310  Lysine degradation
cmd00362  Benzoate degradation
cmd00380  Tryptophan metabolism
cmd00620  Pyruvate metabolism
cmd00630  Glyoxylate and dicarboxylate metabolism
cmd00640  Propanoate metabolism
cmd00650  Butanoate metabolism
cmd00900  Terpenoid backbone biosynthesis
cmd01100  Metabolic pathways
cmd01110  Biosynthesis of secondary metabolites
cmd01120  Microbial metabolism in diverse environments
cmd01130  Biosynthesis of antibiotics
cmd01200  Carbon metabolism
cmd01212  Fatty acid metabolism
cmd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cmd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B841_00720
   00630 Glyoxylate and dicarboxylate metabolism
    B841_00720
   00640 Propanoate metabolism
    B841_00720
   00650 Butanoate metabolism
    B841_00720
  Lipid metabolism
   00071 Fatty acid degradation
    B841_00720
   00072 Synthesis and degradation of ketone bodies
    B841_00720
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B841_00720
   00310 Lysine degradation
    B841_00720
   00380 Tryptophan metabolism
    B841_00720
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B841_00720
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B841_00720
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B841_00720
Enzymes [BR:cmd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B841_00720
Exosome [BR:cmd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B841_00720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt PTA_PTB
Motif
Other DBs
NCBI-ProteinID: AGS33627
UniProt: S5SRK1
Position
152143..153351
Genome map
AA seq 402 aa AA seqDB search
MSSLPTPRADDVVILAGARTPQGKMLGDLAQLSAVDLGAHVIRHAVQRAGIKAEDIDQVV
LGQVIQAGTGQNPARQAAINAGLPWSVPAETVNKVCLSGLDAIIHGTRMVRLGEADVVVA
GGQESMTNAPHIADGVRQGKAYGGLKLTDSLESDGLSDAFDGCSMGTLTEEPMGDLGISR
ADQDEIAATSHQRAARAQQEGVFAAEIAPLEIPQRKGDPLVVDTDQGIRPDTTAESLSRL
RPAFTQNGGTITAGNASPISDGASAVVLARRSWAEERALDHLAVVGAAGQTAGPDNSLHS
QPAASLNHALSRAGWEADELDFIEINEAFGAVAVKSLRDLDYPLEKCNINGGAIALGHPI
GASGARLVLTAAMELSRRGIGRVGVSLCGGGGQGDALLLYRS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtcttcctacaccccgagccgatgacgtcgtcatcctcgccggtgcccgtaca
ccccagggcaagatgcttggcgacctcgctcaacttagtgccgtcgacctcggcgcccat
gtgatcagacacgccgtgcagcgcgcaggcatcaaggcggaggacatcgaccaagtcgtt
ctcggccaggtcatacaggctggcaccgggcagaaccccgctcggcaggccgcgatcaac
gccggcctgccgtggagcgtgccagcggagaccgtgaataaggtgtgcctgtccggcctg
gacgccatcatccacggcacccgcatggtccgactcggtgaggcggatgtcgtggtcgcc
ggcggtcaggagtcgatgacgaatgccccgcacattgccgacggagtccgccagggcaaa
gcttacggcgggctgaagttgacagacagcctggagtccgacggactctccgacgcattc
gacggttgctctatgggaaccctgaccgaggagccgatgggggatctgggcatctcacgg
gcagaccaggacgagatcgcggcgacctcgcaccaacgcgccgcccgggcacagcaggag
ggtgtcttcgccgcggaaattgccccgctggagattccgcaacgcaagggcgatccgctg
gtggtcgacaccgaccagggtatccgccccgacaccaccgccgaatccctgagcagacta
cgcccggccttcacccaaaacggcggtaccatcaccgccggcaatgcctcgccgatctcc
gacggtgccagcgcagtggtgctcgcccgccgctcatgggcggaggaacgcgcactagat
cacctggctgtggtcggtgcggcaggtcaaacggctggcccagacaactctctgcactcc
cagccggccgcctccttgaaccacgcacttagccgggccggttgggaagcagatgagctc
gacttcatcgagatcaacgaggcctttggcgcggtcgcggtgaaatccctccgggacttg
gactacccgctggaaaagtgcaatatcaacggtggagccatcgccctggggcacccgatc
ggagcttctggggcccgactagtgctcaccgcggcgatggagttgtctcgtcggggcatc
ggtcgcgtgggagtcagcttgtgtggtggtggcggccaaggcgacgccctcctgctgtac
cgcagctag

DBGET integrated database retrieval system