KEGG   Corynebacterium maris: B841_01695Help
Entry
B841_01695        CDS       T02784                                 

Definition
(GenBank) hypothetical protein
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
cmd  Corynebacterium maris
Pathway
cmd00460  Cyanoamino acid metabolism
cmd00500  Starch and sucrose metabolism
cmd01100  Metabolic pathways
cmd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B841_01695
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    B841_01695
Enzymes [BR:cmd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     B841_01695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Phage_T7_Capsid
Motif
Other DBs
NCBI-ProteinID: AGS33822
UniProt: S5SS13
Position
352499..354499
Genome map
AA seq 666 aa AA seqDB search
MTTRQPTLGSRSKRIIDHDGLQFRDLDGDGKLTPYEDWRLPAGERAADLVGRMTPQEKAG
LMVIGSHHPGYSGFLPNPSDELLNPEDVWRDANPITSQPYPEPVLVTSSTDNAINLRHQR
FLICRDNLAPKELAVWTNAVQEVAENSRLGIPVSFASNPRNHVALVAQFGVNESAGVFSE
WPNELGLAALDDAELMETFGAEIAKEWRAGGIHKLYGYMADVASEPRWSRFNGTFGEDPG
LASDYTAAVVRGMQGEKLSDASVATTIKHFPGGGVRLDGHDPHFEWGQTNEYPTEDALAT
YHLPPFQAAVDAGASSIMPYYAKPVNSSATQLPAEQWAGPGRQFAEVAFAYDPIFLATIL
REQMGHAGYVNSDSGIIDAMPWGVEELSKPERFAAAVKAGTDIFSDMADPTELNKAYEQG
LLADADLDRACTRLLTELFELGLFDNPYVDEDAAAEIIGAEEISALGAKAQRQSVTLLRT
GEILPLRPNTKIYAYATGRTQIDSVQEKLAAAVEKFGATLVDAPEEADLAIVWARPEIAL
FEDDREGVALSVDPGDNGVDVERVVEIEKTVPTLLAVNMTNPWLLAEIEPGAAAVVATFE
ITPENLLRSLAGEDGGPQGTLPLTVPRSAQAIADSPRDVPGKFCGEDYVYLDRDGVAYSY
GHGLRY
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccggcaaccgacactgggatcccgcagcaaacgcatcatcgaccacgacgga
ctgcagttccgcgacctcgacggcgacgggaagctgaccccctacgaggactggcgcctg
ccggcgggcgagcgcgccgccgacctcgtgggacgcatgaccccgcaggaaaaggcgggg
ctcatggtcatcggctcgcaccaccccggctactccggcttcctgccgaacccgagcgac
gagctgctcaaccccgaggacgtctggcgcgacgccaacccgatcacctcccagccctac
ccggagccggtgctggtgacctcgtccacggacaacgccatcaacctgcgccaccagcgc
ttcctcatctgccgtgacaacctggccccgaaggagctggcggtctggaccaacgcggtg
caggaggtcgccgagaactcccggctgggcatccccgtcagcttcgcctccaacccgcgc
aaccacgtggcgttggtcgcccagttcggcgtcaatgaatccgccggcgtgttctccgaa
tggccgaacgaactcggcctggccgcactcgacgacgccgagctgatggagaccttcggc
gcggagatcgcgaaggaatggcgcgccggcggcatccacaagctctacggctacatggcc
gacgtcgcctccgaaccgcgctggtcgcgcttcaacggcaccttcggcgaagaccctggg
ctggccagcgactacacggcggccgtggtccgcggcatgcagggagagaagctttccgac
gcctccgtggccaccaccatcaagcacttcccgggcggcggcgtgcgcctcgacggccac
gacccgcacttcgagtggggccagaccaacgaataccccaccgaggatgccctggcgacg
tatcacctgccgcccttccaggcggccgtcgacgccggcgcctcctcgatcatgccgtac
tacgccaagccggtgaacagctccgccacccagctgcccgccgagcagtgggccgggccg
ggccggcagttcgccgaggtcgccttcgcctacgaccccatcttcttggccaccatcctg
cgcgagcagatggggcatgccggttacgtcaactccgactccggcatcatcgacgccatg
ccctggggcgtggaggagctgagcaaacccgagcgcttcgccgcggccgtcaaggcgggc
acggacattttctccgacatggccgatcccaccgagctgaacaaggcctacgaacaaggc
ctgctcgccgacgccgacctcgaccgcgcctgcacccgcctgctgaccgaacttttcgag
ctggggctcttcgataacccctacgtcgacgaagacgccgccgccgagatcatcggcgcc
gaggagatctccgcgctgggcgccaaggcccagcgacagtccgtcaccctgctgcgcacc
ggcgagatcctgccgctgcgcccgaacacgaagatctacgcctatgccaccggccgcacc
cagatcgactcggtgcaggaaaagctggcggcggccgtcgagaagttcggcgccacgctg
gtggacgccccagaggaagccgacctggcgatcgtctgggcgcgcccggagatcgcgctg
ttcgaagacgaccgcgagggcgtggccctgtccgtcgacccgggcgacaacggcgtcgac
gtcgagcgcgtcgtcgagatcgagaagaccgtacccaccctgctggccgtcaacatgacc
aacccgtggctgctcgccgagatcgaaccaggcgccgcggcggtggtcgccaccttcgag
atcaccccggagaaccttctgcgctccctggcgggcgaggacggcggcccgcagggcacg
ctgccgctgaccgtgccacgctccgcgcaggccatcgcggattccccacgcgacgtgccc
ggcaagttctgcggcgaggactacgtctaccttgaccgcgacggggtggcctactcctac
ggacacgggttgcgctactag

DBGET integrated database retrieval system