KEGG   Corynebacterium maris: B841_02255Help
Entry
B841_02255        CDS       T02784                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
cmd  Corynebacterium maris
Pathway
cmd00790  Folate biosynthesis
cmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B841_02255
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmd04147]
    B841_02255
Enzymes [BR:cmd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     B841_02255
Exosome [BR:cmd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B841_02255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AGS33934
UniProt: S5SS34
Position
complement(482235..482540)
Genome map
AA seq 101 aa AA seqDB search
MSDPKQILSPNDVRDADLTGWKQVDQALEATFDTGDFATGLKLVNLLGESAESANHHPDV
TLTYPAVAVTLTSHDVGGVTSRDIDLARVITEHAESLGVSA
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccgaagcagatcctgtcccccaacgatgtccgcgacgccgacctcaccggc
tggaagcaagtcgatcaggccctggaggccacgttcgacaccggtgacttcgccaccggc
ctgaaactggtcaacctgctcggcgaatccgccgagtccgccaaccatcaccccgacgtc
acgctgacctacccggccgtcgccgtgacgctgaccagccacgacgtcggcggcgtcacc
agccgggacatcgatttggcccgcgtcatcaccgaacacgccgagtctttgggagtcagc
gcctaa

DBGET integrated database retrieval system