KEGG   Corynebacterium maris: B841_10540Help
Entry
B841_10540        CDS       T02784                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
cmd  Corynebacterium maris
Pathway
cmd00220  Arginine biosynthesis
cmd00250  Alanine, aspartate and glutamate metabolism
cmd00471  D-Glutamine and D-glutamate metabolism
cmd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmd00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B841_10540
   00220 Arginine biosynthesis
    B841_10540
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    B841_10540
Enzymes [BR:cmd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     B841_10540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase STAS STAS_2
Motif
Other DBs
NCBI-ProteinID: AGS35580
UniProt: S5T4P1
Position
complement(2290583..2291833)
Genome map
AA seq 416 aa AA seqDB search
MHNLISDYLGEILDDVRDHVDGEIPTYITSLTKADPDWLGIAMCTTSGRVYEAGDAEVLF
TIQSVSKPFIYALALQECGLERVLDVAGMEPSGEAFNELSLREEDKRPLNPMINAGAIAV
NQLINGEDSSVEDRVDVIFDFLSKLAGRELEMDEESAVDELEKADRNLSIAHMLRSHDVI
VDAAHDAVDSYTRQCSALVTVRDLAVMSGTLANGGVQPVTGEKLLDPEVCRQTLSVMSSC
GMYDAAGRWMARVGIPAKSGVSGGLIGMLPGQLGIATLSPRLDPAGNSVRGVDVFEDLST
DMGLHLMSTEHRTGSHAVRSVDRSGEDTIITLQGVVTFTAAEEILHKLNSLDFVSERVVL
DVSRVIDSHSMGRRMLKEQLQRIREAGYDIAVVDPDAELRGRQLSDGSQIPLAEDL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgcacaacttgatcagcgactacctgggggagatcctcgacgacgtccgcgaccacgtg
gacggggagatcccgacctacatcacctccctgaccaaggcggacccggactggctgggc
atcgccatgtgcacgacctccgggcgcgtctatgaggcgggcgacgcggaggtgttgttc
acgatccagtcggtgtccaagcccttcatctacgctctggccctccaggagtgcgggctc
gagcgggtgctggacgtcgccgggatggagccctccggcgaggcgttcaacgagctttcc
ctccgggaggaggacaaacgccccctcaaccccatgatcaacgccggggccatcgcggtg
aatcagttgatcaacggcgaggactcctccgtggaggatcgtgtcgacgtcattttcgac
ttcctgtctaaattggccggccgcgagttggagatggacgaggaatccgccgtcgacgag
ttggagaaagccgaccgtaacctctccatcgcgcacatgctgcgcagccacgacgtcatc
gtcgacgccgcccacgacgccgtggacagctacacccgccagtgctccgccctggtcacc
gtccgcgacctcgcggtgatgtcagggaccctggccaacggcggcgtgcagccggtcacc
ggggagaagttgctggatcccgaagtgtgccggcagacgttgtccgtgatgagctcctgc
ggcatgtacgacgcggccggccgctggatggcgcgcgtcggcattcccgcgaagtccggc
gtgtccggcgggctgatcggcatgctgcccggccagctgggcatcgcgacgctttctccg
cgcctggatccggccggcaactcggtccgcggcgtcgacgtcttcgaggacctgtccacg
gacatggggctgcacctgatgtccaccgaacaccgcaccggctcccacgccgtgcgctcc
gtcgaccgcagcggcgaagacaccatcatcactctgcagggcgtggtgaccttcaccgcc
gcggaagagatcctgcacaagctcaacagcctggatttcgtctccgagcgcgtcgtcttg
gacgtcagccgcgtcatcgactcccattcgatgggccggcgcatgctcaaggagcagctg
cagcgcatccgggaggcaggctacgacatcgcggtcgtggatccggacgcggagctgcgc
ggacgtcagctttccgacggttcccagatcccgctggccgaagacctgtag

DBGET integrated database retrieval system