KEGG   Cyanidioschyzon merolae: CYME_CMB019CHelp
Entry
CYME_CMB019C      CDS       T00175                                 

Definition
(RefSeq) similar to U3 snoRNP component Mpp10
  KO
K14559  U3 small nucleolar RNA-associated protein MPP10
Organism
cme  Cyanidioschyzon merolae
Pathway
cme03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:cme00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    CYME_CMB019C
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cme01009]
    CYME_CMB019C
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cme03009]
    CYME_CMB019C
Protein phosphatases and associated proteins [BR:cme01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CYME_CMB019C
Ribosome biogenesis [BR:cme03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    CYME_CMB019C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mpp10
Motif
Other DBs
NCBI-GeneID: 16992231
NCBI-ProteinID: XP_005535131
UniProt: M1V3P7
Position
2:complement(44975..47836)
Genome map
AA seq 953 aa AA seqDB search
MHETAAALREWHARLLSWEAAQTDPGRVAEPSGASELRILCKLLFDSAAKTLEWQTKRRC
LGRRAAALRSTLGELKRLSIAGFDLEQVWAELETRNRSLCAAARKTLERIESEFATGGGS
AQCIEVASTADTAPSQDNGTLKRVRFDDERNETREFVRDQDEEVGCMSPNFFFDDDDDEN
DNDEFIIGHAMLEACDTMYDAGSSTSDSSERDEMDEAACGDFGANVGHEALRKFGHTSAD
MELNSLASDAAASVKRRALSTNAASVADESAPDCLLSDESNEKGPGHSDTCDNAIESAHN
VAAPEANTAGASASGSEAQSLPQHSNANNRSEALPSHVAQLDPWIEQTPDASWSSAESPT
ASIDNIDDASLDSFGTDDDSGTLESSASPEDDVYYEQFFGSEASDSLRSDASPREQSFPH
RKRNQYTNATMDTKSQPAENRHDSKHNAHKLSTAAPTLDNTSTCTPVTTPEPAQTSAFER
CEALLRTRARSLEKFNLEEKPWQLRGEVTGHERPVDSVLDAELDFDLSVARRPRIRTHAY
EAALAGNHVDEAAISDRAADSDTDTSQDTDTHVLTEASIRRRVLQRVLDQAFDDVQRRVR
PSAADAAAAAAAAAAPDAGAFELSQERSAQGLAELYAGRDAATAGAQGIVRGASTQTPKS
PRNPLEQQVDALFGELASAIATQTEVAERVLETRSFAVADGWSLRPQKLVSDATQTVAVG
EAPWMVLGRGDVPGAEAAALAEQRVARDPVREQASRLGVDTDASLRLKQGDTEASRSSRR
TRRNRLKRLVRSRLRRKRETAEQRQRATEWLQEAALRDSIAAWEAKSRGRSRHESRIAGE
TDRDQQVVYEQALRVVQQAQAQADAQARAHVSRGQYAGIRIRKAEHVAEQPARGSTDPAH
TSSIQCGGARRTRRLEPGDDRVQAGGGSGSATLYLQLRRQLDREIQRQKTSSL
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgcacgaaacagcagccgcactgcgcgagtggcacgctcgcctgctgtcctgggaggca
gcgcaaacggaccccggacgagttgcggaaccgagcggggcctcggaactccgtatcttg
tgtaagctgctgtttgactcggctgcgaagacgcttgagtggcaaacgaagcggcgatgc
ctgggaaggcgcgcagcggctttgcgatcaacgctcggcgaactcaagcgattgagcatc
gccggtttcgatctcgagcaagtttgggccgaactcgaaacacgaaaccgatcgttatgt
gcagctgcgaggaaaacgcttgagcgaatagaaagtgagtttgcaacgggcggcggaagc
gctcaatgtatagaggttgcttctaccgcggacacagcgccgagccaggataacgggaca
ctgaagcgggtacgcttcgatgacgagcgcaatgaaacgcgggaatttgttcgggaccaa
gacgaggaggttggctgcatgtcgccaaactttttcttcgatgacgatgacgatgaaaat
gacaatgatgaatttatcatcgggcatgcgatgctggaggcgtgcgataccatgtatgat
gctggttcgtcgacctcagactccagtgagcgggacgaaatggatgaagcagcgtgtggc
gactttggtgcgaacgtcggccacgaagcgctacgcaagtttggccatacgagtgcggat
atggagttaaactcgcttgcgtcagatgctgctgcgtcggtgaagagacgcgccctgagt
acgaacgcggcgtccgtagcggatgaatcggcaccagactgcctgctctctgacgaatcg
aatgaaaaaggcccaggtcatagcgatacctgcgataacgccattgaatcggcgcacaat
gttgcagcgcctgaagcgaacaccgccggtgcatctgcctccggttccgaggcccagtcc
ctgccgcagcactccaacgcaaacaatcgcagtgaagcgttgccgtcgcatgtggcccag
ttggacccctggatcgagcagacaccagatgcgtcatggtcaagcgcggaatcaccaaca
gcaagtatcgacaacatagacgatgcctcgttagattcgttcgggacagatgatgactca
ggcacactggaatcctcagcttctccggaagatgatgtctattacgagcagtttttcggc
tcagaggcatccgactcgttgcgctccgatgcatcgccacgcgagcaatcatttccacac
agaaagcgcaaccaatatacaaacgctacaatggataccaagtcgcaaccggcggagaat
agacacgacagcaagcacaacgcacacaagctttcaacagcggcgccaactctggataac
acgtccacgtgcacaccagtgacaacacctgaacccgcccaaacatccgcgtttgaacgg
tgcgaggcgctgttgcgaacccgagcccgttcactagagaaatttaacctagaggagaag
ccctggcagcttcgcggtgaagttaccggtcatgagcgccccgtagactccgtcctcgat
gccgagctagactttgatctgtcggtggcgcgtcgaccgcgcattcgcacgcacgcctac
gaggcagcgctcgcaggcaaccacgtcgatgaagcggcgatctcggatcgcgctgcagat
tcagacacggacacgtcacaggacacggacacgcatgtgctcacggaggcgagcatccga
cgacgtgtcctgcaacgtgtccttgatcaggcgttcgatgatgtgcagcggcgcgtgcgg
ccttcggcggcggatgctgctgctgctgctgctgctgctgctgcgcctgatgctggcgca
ttcgagctatcgcaggagcgctcagcgcagggcctcgctgaactctacgccggccgcgac
gctgccacagccggggcgcagggcatcgtgcgtggcgcctcgacgcagacgccgaaatcg
ccccggaatccgctagagcaacaggtggatgcgttgttcggggagctggcttccgcaatc
gcgacacagactgaggtggcagagcgagtactggaaaccaggtcattcgcggtcgcggac
ggctggtcattgcgaccgcaaaagctggtatccgatgcgacacaaacggttgctgtcgga
gaagcgccttggatggttttgggtcgtggcgatgtaccgggagcggaggcggcggcgctt
gcggagcagcgcgtcgctcgcgatccagtccgtgagcaggcctcgcgccttggtgtcgac
accgatgcgtcactacggctcaagcagggcgatacggaagcgtcgcgttcgagtcgtcgg
acgcggcgaaatcgccttaaacgactggtgcgcagtcgcctgcgtcgaaagcgtgaaaca
gccgagcagcgtcagcgtgcaaccgagtggctccaggaggcagccctgcgggactcgatt
gcggcctgggaggccaagtcgcgcggccgttctcggcatgagtcgcgtatcgcgggagag
acggatcgtgatcagcaggtcgtttacgagcaagcgctgcgggtggtacaacaggcacaa
gcccaggccgatgcccaagctcgcgcacacgtcagtcgcggtcaatacgccggtattcgc
attcgaaaagccgagcatgtcgctgagcagccagctcgcggcagcactgacccagcgcac
acgtccagcatccaatgtggcggggcgcggcgcactcggcgtctagagcctggtgacgac
cgcgtacaagcaggtggcggcagcggctccgcgacactctacctacagcttcgtcgccaa
ttagatcgcgagattcaacgccaaaagacatcgtctttgtaa

DBGET integrated database retrieval system