KEGG   Cyanidioschyzon merolae: CYME_CMB025CHelp
Entry
CYME_CMB025C      CDS       T00175                                 

Definition
(RefSeq) protoporphyrinogen IX oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cme  Cyanidioschyzon merolae
Pathway
cme00860  Porphyrin and chlorophyll metabolism
cme01100  Metabolic pathways
cme01110  Biosynthesis of secondary metabolites
Module
cme_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CYME_CMB025C
Enzymes [BR:cme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CYME_CMB025C
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CYME_CMB025C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_3 Pyr_redox_2
Motif
Other DBs
NCBI-GeneID: 16992236
NCBI-ProteinID: XP_005535134
UniProt: M1VEE0
Position
2:60816..62543
Genome map
AA seq 575 aa AA seqDB search
MLRWSGSQQVTDRNRAEQHGLVVAFAFPARAPRHSEATHERWTGLAQRERGLCVPLKATK
WKRDLWHSRKLQMQEPAQRNREQVQALVVGSGVTGSSFAFLLQHAGISDVICTEARGEVG
GNLISRSKDGYLWEEGPNTFQPTPVILKLARDAGLESELVFADAKLPRYVYWEGVLHALP
SSPADLITGRFRLLSNAGKARAALGALGFVGAPKRVARQAGPEPSEDADLADESVEEFVT
RHLGREVFLKIIDPFVSGVYAGDPSKLSMAAAFKRVYALEQLGGTRGILEGALIRLQQRR
RERQRWAAENLPKVKAGALGSFREGLQQLPLTVATRLGPERMRTRYALRQIEYNGAKRGK
RRYTARFETPDGERVIETDALILTIPAHAASPLLQGLGVSGSELLQEIDFPPVYSVTLAY
PKFAARFPLNGFGNLIPRSAGIRTLGMVWSSSLFPERAPPDMNMVLSYIGGARDPGIREC
TPDEVAALVDADMRRVLLRADAPSPQVLGVRLWPRAIPQYNRGHLRRLEACNQGLQGFPG
LFLGGNYLSGVSFGDCVQWAYDNVPRVLTFLQETA
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggtggtccggatctcaacaggtaaccgaccggaaccgagccgaacagcatggc
ctggtcgtggcgttcgcttttcctgctcgagcaccgcgccacagcgaagcaacacacgag
cgctggactgggctggcgcagcgcgaacgcggcttgtgtgtaccgttgaaagcgaccaag
tggaaacgagacttgtggcactcgcgaaagcttcaaatgcaggagcctgcacagcggaac
agagagcaggtgcaagcgctagtagtaggctctggagtgactggctcttcgttcgcgttc
ctgctgcagcacgctggaataagcgatgtgatttgcaccgaggcacgaggtgaagttggt
ggaaaccttatttcgcgttccaaagacggctacctttgggaagaagggcccaacaccttc
caaccaacaccggtgattctgaaactcgcgcgagacgcgggtctcgagtccgagcttgtc
ttcgccgacgccaaactccctcgatacgtatactgggagggggttttgcacgcgctcccg
agttcgcctgcagacctgatcaccggccgtttccgcctgttatcgaatgcggggaaggct
cgggcagcgctcggagcgctcgggttcgtaggcgcacccaaacgcgtcgcacggcaagct
ggacccgagcccagcgaggatgctgacctagcagacgagtctgtagaggaattcgtgact
cgccatctaggccgcgaagttttcctgaagattatagaccccttcgtgagcggtgtgtat
gcaggcgatcccagcaaactctccatggctgcagctttcaagcgcgtgtacgcactcgag
cagcttggcggaacacgcgggattctcgaaggggcgctcatccgtctgcaacaacgtcga
cgggaacgtcaacgctgggcggcagagaatctccccaaggtgaaagcgggtgcactgggc
tccttccgcgagggcctgcagcagttgccgctcacagtggcgactcggctgggccctgag
cgaatgcgaactcggtatgcactgcgccaaattgaatacaatggagcaaaacgtggaaaa
cgtcgctatactgcccgcttcgaaaccccagatggcgaacgagttatcgaaacagatgcc
ctcattcttacgatccccgcacatgcggcgtcaccgctcttgcaaggtctgggtgtctct
gggagtgagctgctccaggaaatcgactttccgccggtatactcggtaactttggcatac
ccaaagtttgcagcgcggtttcccctaaacggtttcgggaacctgataccgcgctctgcc
ggtattcgcaccctcgggatggtctggtcgtcgagtttgtttccggaacgagcgcctccc
gatatgaatatggtgctctcatacatcggcggtgcgcgtgatcctggtatccgcgaatgc
accccggatgaagtcgctgccctcgtagacgcggacatgcgtcgcgtcctcctacgtgcc
gatgcaccttcgccgcaagttcttggtgtgagactttggccgcgggcgattccacaatac
aaccggggtcacttgcggcgcttggaagcctgcaaccagggtctacaaggctttcctggt
ctctttttaggcggaaactatctgagtggcgtttccttcggtgactgcgtacagtgggcg
tacgataatgtgcctcgagtgctgacgtttctgcaggagacggcttga

DBGET integrated database retrieval system