KEGG   Cyanidioschyzon merolae: CYME_CMB046CHelp
Entry
CYME_CMB046C      CDS       T00175                                 

Definition
(RefSeq) similar to JEMMA protein
  KO
K10276  F-box and leucine-rich repeat protein 10/11 [EC:1.14.11.27]
Organism
cme  Cyanidioschyzon merolae
Brite
KEGG Orthology (KO) [BR:cme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cme04121]
    CYME_CMB046C
   03036 Chromosome and associated proteins [BR:cme03036]
    CYME_CMB046C
Enzymes [BR:cme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone-H3]-lysine-36 demethylase
     CYME_CMB046C
Ubiquitin system [BR:cme04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     CYME_CMB046C
Chromosome and associated proteins [BR:cme03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    CYME_CMB046C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_8 JmjC JHD Cupin_4
Motif
Other DBs
NCBI-GeneID: 16992255
NCBI-ProteinID: XP_005535152
UniProt: M1UNB3
Position
2:118063..120267
Genome map
AA seq 734 aa AA seqDB search
MMAERSPIIDAIEDAQRPLVTSDSEMRARDVSAHACRQHGHVLRHTMQRVPARVELPEMP
IGANDAFTAAEIYITPSSISESVPSSCTSCATASACDAETRRLAAIAKRGRATSPCGERS
SQMLPAGRMPASSAAPAAPETLDSMPSYPPDPGPDPRSAANSIGASTNVASHSEHSACGC
LATDQDTKPENQRTTSTRFCICRQPYDARRNGIMVACDNPTCAYGWFHISCLFLDVSRVR
ASKTFICRFCSGTGTDLFTPVQRPKRPRSQHGRPAVTDYARLHEGDIGGALRGGTCAGAL
SEAARAAAERRAQSWAKNATSDAGGLAAHLGILVYGTGGELQRMPDAPCVVLDPDGLDMH
IPHRAYHPEEVGREYGLERHCEVLDVASQSELHPRWSLGQYLDYLATAPALRQRVLNLIS
LEISRTPTGRAFVVPALIRRADWASLYPEPRPHVDKYYLLSGTGSWTSWHIDFGGSTVFY
HVLRGKKRFYMSPPTERHLQLYERWQRDPQQALRELDFVEELSPIAVIDLDAGNTLFIPA
GWLHAVYTPADSVVLGGNILHLGGVVMQHRVFQMENRLRVLPKYQFPLFRELHWLALRQY
ALALREARTPGAVFQTSAVHSERQHLRWLVKHLRDQLHNALTSAPAESPNPTELHTLLRD
RIGLPRRVQLADVQRWLGVLEEALDTAHEHAPESTKAERKRTRRFEKQLRPSPSADALDA
APCRSTRIRSEKRV
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggagcgttcaccaatcatcgacgccatcgaggatgcgcagcggccgcttgtg
acctccgattccgagatgcgtgctcgtgacgtgtcagcgcacgcatgcagacagcacgga
cacgtgctgcggcatacgatgcaacgtgtccctgctcgtgttgagcttcccgaaatgccg
ataggtgcgaacgacgcatttacagctgctgaaatatatataacaccatcatccatatcc
gaaagcgtaccaagttcgtgcacatcctgcgcgacagcgtcagcgtgcgacgcagagacg
cgaaggctcgccgctatcgcgaaaagagggcgcgctacaagcccctgcggtgagcgctct
tcacagatgctcccggcgggtagaatgccagcgagtagtgcggcaccagcagcgcccgag
acgctcgactcgatgccatcgtatccacccgatcccggtcccgatccacggagcgctgcg
aatagcattggtgcttccaccaatgtcgcatctcacagcgagcacagcgcttgcgggtgc
ttggctacagatcaggacacgaaacctgaaaaccagcgcaccaccagtacgcggttctgc
atatgtcgccagccgtacgacgcgcgccgcaacggcatcatggtagcgtgcgacaacccg
acctgcgcgtacggctggttccacatctcttgtctatttctggacgtttcacgtgtgcgg
gcatctaagacctttatttgtcggttctgctccgggacagggacggacctattcactcca
gtgcagcgaccgaaacgcccgcggagccagcatggacgtccggccgtcaccgattacgcc
cgcctccatgagggcgatataggcggtgccctgcggggcggcacctgcgccggcgctctg
agcgaggcggcacgagcggccgctgaacgccgggctcagagctgggcgaagaacgccacc
agcgacgctggcgggctagcggcgcatctggggatactcgtctacggcaccggtggcgaa
ttgcagcgcatgcccgatgcgccctgtgtcgtgctcgatcccgacgggctcgacatgcac
attccacatcgtgcttaccatcccgaggaggtcgggcgcgagtacggacttgagcgtcat
tgcgaagtgctggatgtcgcgagccagagtgagctgcatccccgctggagcctggggcag
tacctggattacctggcaaccgcgccagcgttacgtcagcgggtgctgaacctcatctcc
ttggagatatcacgaacaccgacagggcgagcgttcgtggtgccggcgctgattcgccga
gcggactgggcgtcgctgtatccggagccgcgcccgcatgttgataagtactaccttctg
agcggcactggatcgtggacctcgtggcatatagactttggcggatcgacggtgttctat
cacgtgctgcgcgggaagaagcgcttctacatgtcaccgcctacagagcgccatctgcag
ctctacgagcggtggcagcgggatccgcaacaggcgctgcgtgagctagactttgttgag
gagctgagccctattgccgtcattgacctcgacgcgggaaacacgttgttcattccggcg
ggatggctgcatgctgtgtacaccccagcggacagcgttgtgctgggaggcaacattctc
cacctgggcggcgttgtcatgcagcaccgcgtgttccagatggagaaccgtctacgcgtc
ttacccaagtaccagttcccgctgtttcgagagcttcactggctagcgctccgacagtat
gcccttgcactgcgagaggcgcgcactcccggagcggttttccagacgagtgctgtgcac
agcgaacgccagcacctgcgctggctagtgaagcacttgcgagatcagttacataacgcc
ttgaccagcgcgcccgctgagtctccgaacccaaccgaactgcatacgctgttgcgggac
cgcatcgggctccccaggagggtccagctcgcggacgtgcagcgctggctgggcgttttg
gaggaggcactggatacggcccacgagcacgcacccgagtcgacaaaggccgaacggaag
cggacaaggcggtttgagaaacaactccgcccgagtcccagcgctgacgcactggacgcg
gcgccctgtcgctcgactcggattcgttcagaaaagcgcgtctga

DBGET integrated database retrieval system