KEGG   Cyanidioschyzon merolae: CYME_CME136CHelp
Entry
CYME_CME136C      CDS       T00175                                 

Definition
(RefSeq) dTDP-glucose 4,6-dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
cme  Cyanidioschyzon merolae
Pathway
cme00520  Amino sugar and nucleotide sugar metabolism
cme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CYME_CME136C
Enzymes [BR:cme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     CYME_CME136C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 NAD_binding_4 RmlD_sub_bind adh_short KR NmrA
Motif
Other DBs
NCBI-GeneID: 16992896
NCBI-ProteinID: XP_005535639
UniProt: M1VFN2
Position
5:complement(373038..374087)
Genome map
AA seq 349 aa AA seqDB search
MTPSVSPHPDERVPPIDTTAVWRAQHAPNRTPERQRILVTGGAGFIGSNLVDHLMELGHE
VIVLDSLFTGTKENIAHWIGHPRFDFIRHDVTERIMLEVDQIYHLACPASPLHYKYNAIK
TIKTNVLGTLNMLGIAKRTGARLLLASTSEVYGDPLVHPQPESYWGNVNPIGVRSCYDEG
KRVAETLCFDYYRQHHVDIRVARIFNTYGPRMVENDGRVVSNFVGQALRGEELTIFGDGS
QTRSFCFVSDLVDALIRLMNTEGITGPVNLGNPTEFTVRELAELVRRKLPKSGPIRYLPP
TPDDPGRRQPDIHLARTVLDWAPRVPLEEGLDAMIADFQRRGIGSRPVA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgtcggtttcaccgcaccctgatgaacgtgtcccgccaatagacaccacggcg
gtctggagggcccagcacgcccccaaccgcaccccagagcgtcaacgaatcctcgttacc
ggtggagcgggattcatcggctcgaacctagttgaccatctgatggagcttggtcacgag
gtcattgttcttgattcgttgttcactggtaccaaggagaacattgcgcactggatagga
cacccgcggttcgacttcattcgtcacgacgtcacggagcgcatcatgctggaagtcgac
cagatctaccatctggcgtgtcccgcttcaccgcttcactataagtacaacgcgatcaaa
accattaaaaccaatgtcctgggcacgttgaacatgctcggtatcgcaaaacgcaccggt
gcacgacttctgctggcaagcaccagcgaggtgtacggcgacccactggtacacccacaa
ccagagagctactggggcaacgtcaacccaatcggtgtgcgctcttgctacgacgagggg
aagcgcgtggcagaaacgctctgctttgactattatcgtcagcatcatgtcgacattcga
gtcgctcgtattttcaatacgtacggtccacggatggtggaaaatgacgggcgcgtggtc
agtaattttgtgggccaggcattacgcggagaggagctgaccatttttggcgatggtagc
cagacacgctcgttctgtttcgtcagtgacctggtggacgctctgatccgactcatgaat
acagagggcatcactggtcctgttaacctgggtaatccaacagagttcacggttcgggag
ctcgctgaactggttcgaagaaagctcccgaaaagtggacctattcggtatttgccgccg
acacccgatgatcccggtcgccgacagccggatatccatttggcgcgcaccgtcctcgac
tgggcgccgcgcgtcccgctcgaggagggcctcgatgccatgatcgccgactttcaacgc
cgaggtattggttcgagacccgttgcgtaa

DBGET integrated database retrieval system