KEGG   Cyanidioschyzon merolae: CYME_CMG086CHelp
Entry
CYME_CMG086C      CDS       T00175                                 

Definition
(RefSeq) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
cme  Cyanidioschyzon merolae
Pathway
cme00260  Glycine, serine and threonine metabolism
cme00630  Glyoxylate and dicarboxylate metabolism
cme00670  One carbon pool by folate
cme01100  Metabolic pathways
cme01110  Biosynthesis of secondary metabolites
cme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CYME_CMG086C
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CYME_CMG086C
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CYME_CMG086C
Enzymes [BR:cme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     CYME_CMG086C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-GeneID: 16993260
NCBI-ProteinID: XP_005535891
UniProt: M1V4Q9
Position
7:complement(227285..228709)
Genome map
AA seq 474 aa AA seqDB search
MAARILNRWLELSAVCASEVRFVAGKHPGHRLSAPVALLRGETHKRLSPLNWIANGHLRY
RQASTTSATQPSPEEKLKHTALYETHLKYGGKMVPFAGYALPVMYSGEKGGIKNEHLQVR
QSAGVFDVSHMGQVRVYGTDRVRFLERLIVADLQALPAGTAVLSLLTNEHGGIIDDTIIT
NLGKDNTGAEALNMVINGACVDKDMAHLRAHERRAREVDGMDVRLEFLADRSLLALQGPK
AMQVLQHIVDRSTLNLEQMAFMNARMVKAPAFSDYLLVSRCGYTGEDGFEISVHNQDAPK
LFEMLVSNEAVLPCGLGARDSLRMEAGLCLYGNDIDENTTPVSAGLTWTIAKSRRNPDSG
DGRPSFLGADVILKEIANPSIVQKKRVGFVLHGGPPARGHETIHENSPKAADNAVIGTVT
SGGFSPTRNCAIGMGYISKPMDAVGTRISVKIRGKLVPGEVVKMPFVKTNYYKP
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcggattctgaacaggtggcttgaattgagcgcagtatgtgcgtcggaagtg
cgttttgtagcggggaagcaccctgggcaccgcctaagtgctccggtagcgctgttgcgg
ggcgaaacgcacaagcgtctgtcaccgttgaattggattgcaaacggtcatttgcgctac
cgccaggcaagcacaacgtccgccacgcagccgagccctgaggagaaactcaaacatacc
gcgctgtatgagacgcacctgaagtacgggggcaaaatggttccctttgcaggctatgcg
ctcccagtgatgtactctggcgagaaaggcgggataaaaaacgagcacttgcaggttcgt
cagtcggctggtgtgtttgatgtctcgcacatggggcaggtgcgcgtgtacggcaccgac
cgcgtccgcttcctcgagagactcatcgtcgcggatctacaggcactcccggcgggtaca
gcggttttgtcgctactcacgaacgagcacggaggtatcattgacgatacgatcattacg
aacctaggaaaggacaatactggggcggaagccctgaatatggtgatcaatggcgcctgt
gtcgataaggacatggcgcacctgcgagcacatgagagacgcgcccgcgaggtcgacggc
atggatgttcgcttggagtttttagcggatcgctcgctgctggcacttcaaggcccgaaa
gcgatgcaggtactgcagcatattgtcgaccgaagcacactgaacctagagcagatggcg
ttcatgaatgctcggatggtcaaggcacctgctttctctgattacttgctcgtatctcgt
tgcgggtatacaggagaggacggctttgagatcagtgtgcacaatcaggatgcgccgaag
ctcttcgaaatgctcgtgtccaatgaagcggtgcttccgtgtggtctcggtgcacgggac
tcgctgcgcatggaagctggcctttgtctctacggtaacgatattgatgagaacacgacg
cccgtgagcgctggtttaacgtggacgattgccaagtctcgccgcaacccagactccggt
gatggccggccctcgttcctcggtgcagacgtgatactcaaggagattgccaatccaagt
atcgtgcagaagaaaagagtaggctttgtccttcacgggggaccaccagctcgtggacac
gaaacgattcacgaaaattcaccgaaagctgccgataacgccgtgatcggtactgtgact
tcgggaggattctcccccacacggaactgcgctattggtatgggttacatctcgaagcct
atggacgctgtcggtacgcgtatttcagtgaaaattcggggaaaacttgtgccaggtgaa
gtagtcaaaatgccattcgttaagacgaactattacaaaccctaa

DBGET integrated database retrieval system