KEGG   Cyanidioschyzon merolae: CYME_CMH026CHelp
Entry
CYME_CMH026C      CDS       T00175                                 

Definition
(RefSeq) similar to (N6-adenosine)-methyltransferase
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
cme  Cyanidioschyzon merolae
Brite
KEGG Orthology (KO) [BR:cme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cme03019]
    CYME_CMH026C
Enzymes [BR:cme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     CYME_CMH026C
Messenger RNA biogenesis [BR:cme03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     CYME_CMH026C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MT-A70 ZZ
Motif
Other DBs
NCBI-GeneID: 16993363
NCBI-ProteinID: XP_005536017
UniProt: M1UQD8
Position
8:78607..80487
Genome map
AA seq 626 aa AA seqDB search
MKGERKRPQRHDRDADRELALRLHNEEKQELRGLRRQTRTSADKAVVEDATVMGRPCETV
TGLDSFLSSCLNETGRHSRPRASRKRTVENAFEHFSVAKYTEKHAKLEPRKQGTSALPID
EIQTVPIKDLDQFPSCVGVAENQKTSSSLRRQIREQIRRLNDGYYINCDLRYFNLAYLRE
CVGNFDVVLIDPPWRIAGGQRASTPNGPMFTNNHWAVNYNTLSNEEILDLDIGCLSNSGL
CFLWVVSSQLPTGMACLSRWGYEYIDKITWIKKRQGKLHVSHGYHFMHSSELCLIGVKRP
CEFIGKVSNDLIFAEVREKSRKPDELYHVVETMLPGTAKIELFARNHNIRRGWLSLGNEL
GEQFCDWFNDFECDMCGARIHFGERRYKAKNRPNSDFCRDCYLEAISAGVTTETEWFELA
NDAADPVYHEYYECNHCNIYPLWGVRFHRDPDMDLCEQCYDELVANDAETEDASNNARTS
SPDDWTAIESPICGGSLPVHRNIRCSSCLQCPIIGYRFSCTCCENLSLCQKCFFQQKCPK
GHNADHDIVIIVDSEAALNALVRCDGCGIRPILGTRYRCNTCYAFDLCETCYKKVEQGEY
DLQQVSQKKLAEHNRSHAFSAIPVSA
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggagaacggaaacgccctcagaggcacgacagggacgcagatagagagctggcg
ttgcgcctccacaacgaagaaaaacaggagcttcgaggtttgcgtcgccagacccgaact
tctgcggataaagctgttgtggaagacgcaacagtgatgggtagaccatgtgagacagtc
actggattggattcttttctgagctcctgtctaaacgaaacaggccgacattcacgcccc
cgagcgagcaggaaaagaacagttgagaacgcttttgagcatttttctgtcgcaaaatat
acagaaaagcatgcaaaactcgaacctcgcaagcaaggtaccagcgccctacccatagac
gagattcagactgtgccaatcaaggacctcgatcagtttccgagctgtgttggagttgca
gagaaccagaaaacctcaagcagtcttcgtaggcagatacgggagcaaattaggcgcttg
aatgatggatactacatcaactgtgatcttcgttacttcaaccttgcgtacttgcgtgaa
tgtgtggggaatttcgacgtggtgctcattgatcccccgtggcgcatcgcgggcggccag
cgagcgagcacgccgaatggacccatgttcaccaataatcactgggcagtcaactataat
acgttgtccaatgaagagattctggatttggacattggatgcctctcgaatagtggtctc
tgtttcctctgggtcgtctcatcccagctgccaacaggtatggcctgcctctcgcgctgg
ggctacgaatacattgacaaaatcacgtggatcaagaagcgccaggggaagctccacgtg
agccacgggtatcatttcatgcattcatctgaattgtgtctcattggggtcaagcggccc
tgcgaattcattggaaaagtttcaaacgatctcattttcgcagaggtgcgtgaaaaaagt
cgcaaaccagatgaattgtaccatgttgttgagacaatgcttccaggtactgccaagata
gagcttttcgctcggaaccacaatattcgcagaggctggctgagtttgggtaacgagctc
ggtgagcagttctgcgactggttcaatgacttcgaatgtgacatgtgcggagcacgcatt
catttcggtgagaggcggtacaaagcgaaaaatcgacccaattcggacttttgtcgggac
tgctatctggaagcaatttccgcaggagtgacaacggaaacagagtggttcgagctggct
aatgatgccgcagatcctgtctatcatgagtactacgagtgcaatcattgcaacatctat
cccctttggggagtccgctttcatagagacccagacatggatctttgtgagcagtgctat
gatgagctggtagccaatgacgcggaaacagaggatgcgtccaataatgcacgcaccagc
agccctgacgactggactgcgatcgagtctcctatttgcggcggctcgttacctgtccac
cgcaatattcgctgttcatcctgcctccagtgtccgatcattggataccgcttctcatgc
acctgctgcgagaatttaagcttgtgtcaaaaatgcttctttcaacaaaaatgccccaaa
gggcacaatgcagatcatgacatagtgatcattgtcgattctgaggccgcactgaacgcg
cttgttcggtgcgatggatgtggaattcgccccatccttggtacgcgatacagatgcaat
acctgttacgcctttgacctgtgtgagacgtgttacaagaaagttgagcaaggagaatac
gatttgcaacaggtttctcaaaagaagttagcggaacacaatcgatctcacgcgttttca
gcgattcccgtctcagcctga

DBGET integrated database retrieval system