KEGG   Cyanidioschyzon merolae: CYME_CMH061CHelp
Entry
CYME_CMH061C      CDS       T00175                                 

Definition
(RefSeq) eukaryotic translation initiation factor eIF-2 beta subunit
  KO
K03238  translation initiation factor 2 subunit 2
Organism
cme  Cyanidioschyzon merolae
Pathway
cme03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cme00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    CYME_CMH061C
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cme01009]
    CYME_CMH061C
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cme03012]
    CYME_CMH061C
Protein phosphatases and associated proteins [BR:cme01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CYME_CMH061C
Translation factors [BR:cme03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    CYME_CMH061C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: eIF-5_eIF-2B
Motif
Other DBs
NCBI-GeneID: 16993394
NCBI-ProteinID: XP_005536043
UniProt: M1VBM2
Position
8:complement(172829..173713)
Genome map
AA seq 294 aa AA seqDB search
MPPNENGAFQESSGNLAEVSASTGAGATADTAAALNTAEPLLFDPSMKKKKKKKPVEQGT
NAGDTTTALDSEQAPTERHVHFQVESDGDRAASPVDSGTAVNAGTITTSSSSVSHENNME
AAEPWQGTDRDYTYDELLRRIFDMLHGRHPGLGGNPDGRRRLSLRPPQIAREGSKRTVFL
NFGDICQSLRRQPEHLAAYMAAELGTTGNLQESARLVLKGRFQPAGFEGVLRRYIREYVM
CASCKSPETVLMRDAHTRLYFMKCENCGSSRSVAPIRQGFMAQTERRSLRRDAA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcccccgaatgaaaatggtgccttccaggagtcgagcgggaaccttgccgaggtgtcc
gcgtcgactggcgccggcgcaactgcggacaccgctgctgctttgaacacagcggagccg
ctgctgttcgacccatcgatgaagaaaaagaagaagaagaaacctgtagaacaaggaacg
aatgccggggatacgacaactgcgcttgactcggaacaggctccgacagaacggcacgtg
cacttccaggtcgaatccgacggcgatcgagcggcgtcgcctgtcgacagcgggacagcg
gtgaacgcaggcaccatcacgacgtccagcagcagcgttagccatgaaaacaatatggag
gcagcggagccgtggcaaggtacggatcgtgactacacctacgacgagctccttcgccgc
atcttcgacatgctccacggacggcacccgggtctgggcgggaacccggacggtcgtcgc
cgcttatcgctacgacctccgcagattgcacgagaaggctccaagcgtaccgttttcctt
aattttggggatatatgccagtcactgcgtcgacaaccggagcacttggcagcctacatg
gccgctgagctcggcaccaccgggaatctgcaggagagtgcccgtctggttctcaaaggg
cgattccagcccgctggtttcgagggtgtgctgcggcgttacatccgcgaatacgtcatg
tgtgcgagttgcaagagccccgagaccgtgctcatgcgcgatgcccatacgcggctctac
tttatgaagtgcgaaaactgcggctcctctcggtcggtggctccgattcgacagggattc
atggcacagaccgagcgaagatcgcttcgacgtgacgccgcctag

DBGET integrated database retrieval system