KEGG   Cyanidioschyzon merolae: CYME_CMH071CHelp
Entry
CYME_CMH071C      CDS       T00175                                 

Definition
(RefSeq) 60S ribosomal protein L5
  KO
K02932  large subunit ribosomal protein L5e
Organism
cme  Cyanidioschyzon merolae
Pathway
cme03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cme00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CYME_CMH071C
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cme01009]
    CYME_CMH071C
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cme03011]
    CYME_CMH071C
Protein phosphatases and associated proteins [BR:cme01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CYME_CMH071C
Ribosome [BR:cme03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    CYME_CMH071C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L5e Ribosomal_L18_c K_oxygenase
Motif
Other DBs
NCBI-GeneID: 16993403
NCBI-ProteinID: XP_005536050
UniProt: M1V7H2
Position
8:192710..193606
Genome map
AA seq 298 aa AA seqDB search
MAFVKVVKNKAYFKRFQVKPRRRREGKTDYHARRALIIVDKTKYNTPKYRLVVRITNSDV
ICQIVTARVEGDKVIAAAYAHELPRYGIKVGLTNFAAAYATGLLVARRTLTILGLADAYQ
GKVEADGELYQVEPVGETRPFRAVLDVGLVRTTTGHRVFAAMKGAVDGGIDIPHSEKRFP
KYKKGSEFDPEELKARIYGNHVADYMRMLREEDPEKYQRQFSRYIQAGIDPDQLEDMYRE
AHRRIREDPRAVLTDKSRVTKRPRKTPKLSREEKQARLAARLAALARSGATESMVTVS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgtcaaagtcgtcaaaaacaaggcatacttcaagcggttccaagtcaagcct
cgacgccggcgggaagggaagactgactaccacgctcgaagggccttgatcatcgttgac
aaaaccaagtataacaccccaaagtatcgtcttgtcgttaggattacgaactcggatgtg
atctgccagattgtaacggctcgtgttgaaggagacaaagtgatagcagcggcgtacgcg
cacgagctccctcgttatggcatcaaggttggtctgacgaactttgctgcagcctatgcc
actggtttactcgtagcccggcggacgctgacgattctcgggcttgccgatgcataccag
ggtaaggttgaggcggacggcgagctttaccaggtggagccggtcggggagacccgcccc
ttccgagcggtgctggacgtcgggctcgtgcgaacgacgactggccatcgggtgttcgcg
gcgatgaaaggcgcggttgatggaggaatcgatattccacacagcgagaaacgtttccca
aagtataagaagggatccgagttcgaccctgaggagctgaaagcacgcatatatggtaac
cacgtggccgactacatgcgaatgctacgagaggaagatcccgaaaagtaccagcggcag
ttctctcgttatattcaagcaggaattgatcccgatcagttggaggacatgtatcgggag
gcccatcgacgcatccgagaagatccacgcgcggttctaaccgacaagtctcgtgtaacg
aagcgcccacgaaagacacctaagttgagtcgcgaagagaagcaggcgcggctggcggcg
cggttagcagcgctcgcccgctctggcgccacggaatcgatggtaaccgtttcatga

DBGET integrated database retrieval system