KEGG   Cyanidioschyzon merolae: CYME_CMI224CHelp
Entry
CYME_CMI224C      CDS       T00175                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cme  Cyanidioschyzon merolae
Pathway
cme00030  Pentose phosphate pathway
cme00480  Glutathione metabolism
cme01100  Metabolic pathways
cme01110  Biosynthesis of secondary metabolites
cme01200  Carbon metabolism
Module
cme_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CYME_CMI224C
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CYME_CMI224C
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cme04147]
    CYME_CMI224C
Enzymes [BR:cme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CYME_CMI224C
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CYME_CMI224C
Exosome [BR:cme04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CYME_CMI224C
  Exosomal proteins of colorectal cancer cells
   CYME_CMI224C
  Exosomal proteins of bladder cancer cells
   CYME_CMI224C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 16993742
NCBI-ProteinID: XP_005536380
UniProt: M1V7U8
Position
9:605422..607164
Genome map
AA seq 580 aa AA seqDB search
MSSLPTSSRLMSLRERTEIPVVGDDGSHIDPSNSCSPRRSLSNSSRGYERASRGLTRVAS
ASSALSLVSNPNLSLLDSELQVVEDCKEFPVVVVVVGASGDLARKKTLPALFSLFYHNLL
PLSFAVVGYARSKLSVEEFRSSVSSNLVCRVGDRECCEAKTRAFLERCFYFSGQYGSLED
WLNFDRWLSEDIEPRMNQSDTATRGARRAPGRLFYLAIPPSVFAETLRSISRGAMAPEEL
GAWTRVIVEKPFGRDSESYMALRDLVAECFPEEALYRIDHYVGKPLVANLTTLRLGNFVF
DALWNRHCIESVQVVFKEDFGVEGRAGYFDAYGIIRDILQNHLLQVLSIIAMDPPASPHA
ADINEAKLRLLYDIKPLHAKDFIIGQYDRYRSERGVPKDSCTATFAACVVQIDNERWRGV
PFVMLAGKALDERKVYVKVAFHETPNHTFIPEELRDKRNTFYIEIQPRPAVELSFITKTP
DLEGRVVQTKLDLVYNESFSAEAQDMPDAYERLISDAIVGDRTLFISDAQISRAWELFDP
ALKELERDPPVQPVIYPYGSKGPILPETLIKKYMAGRMQD
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcactgccaacttcgtcacggcttatgagtttgagggaacgtacggaaataccg
gtggtcggagatgacgggagccatatcgacccgtcaaactcgtgttcaccaaggcggagc
ctgtccaacagcagtcgtggatacgaacgagcatcccggggtctgacacgggtcgcgtcc
gcgtcgtcagcgctgtcgcttgtgtcgaacccgaacctgtcgctgttggactctgagctt
caggttgtagaagactgtaaggagttcccggtcgtggtcgttgtggtcggtgcatcagga
gatctggcccgcaagaagacgctgccggccttgttctcgctcttctaccacaacctgctg
ccgctcagtttcgcagtcgtcggatatgcccgctcaaagctctccgtagaagagtttcga
agttcagtgagctcgaatctagtctgtcgcgtcggagatcgcgagtgctgtgaggcgaag
acgagggcctttctcgaacgctgcttctacttctctgggcagtatggctctctggaagac
tggttgaattttgatcgctggctttccgaagacatcgagccgcgtatgaaccaaagcgac
acagcaactcggggggcacgacgcgcgcccgggcgtctgttttacctggcgatcccgccg
tcggtattcgcggaaacgctgcgcagtatcagtcgcggcgccatggcacccgaggagctt
ggcgcctggacccgagtcattgtcgagaaaccatttgggcgagactcagagtcctacatg
gcgctacgtgacctagtcgcagaatgctttccggaggaggcactttaccgcattgatcat
tacgtgggcaagccactggttgcgaacctgacgacacttcgacttgggaactttgttttt
gatgcactctggaatcgccactgcattgaatccgtgcaagtggtgttcaaggaggatttc
ggggtcgagggtcgcgccggctacttcgacgcatacggcatcattcgagatatcctccaa
aaccatttgctgcaggtcctcagcattattgcgatggatccgccggcgtcgccgcacgct
gccgatatcaacgaggcaaaactccggctactgtacgacatcaaaccgttgcatgcgaag
gattttatcatcggccagtacgatcgatatcggtcggagcgaggcgtgccgaaagactcg
tgcaccgccacgttcgcagcgtgtgttgtccagatcgataacgaacgctggcgaggtgtc
ccttttgttatgctcgctgggaaagcgctcgacgagcggaaggtttacgtgaaggtcgcg
ttccacgagacaccgaatcatacgtttataccggaggaactgcgtgacaagcgcaacacg
ttttacattgaaatccagccgcgtcccgcggtcgagctgagctttatcaccaaaactccc
gatctggagggacgcgttgtccaaaccaagctcgacttggtctacaacgagagcttcagt
gcggaagcccaggacatgccggacgcctacgagcggctcatttcggacgccattgtgggc
gaccgcacactcttcatcagcgacgcccagatatcgcgcgcatgggagctgttcgaccct
gccctgaaagaactggagcgagatccaccagttcagccagttatctatccgtatggtagt
aagggaccgattctgcccgagacgctgatcaagaaatacatggcaggcaggatgcaagac
tga

DBGET integrated database retrieval system