KEGG   Cyanidioschyzon merolae: CYME_CML148CHelp
Entry
CYME_CML148C      CDS       T00175                                 

Definition
(RefSeq) hypothetical protein
  KO
K02607  origin recognition complex subunit 5
Organism
cme  Cyanidioschyzon merolae
Brite
KEGG Orthology (KO) [BR:cme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cme01009]
    CYME_CML148C
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cme03032]
    CYME_CML148C
Protein phosphatases and associated proteins [BR:cme01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CYME_CML148C
DNA replication proteins [BR:cme03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    CYME_CML148C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ORC5_C AAA_16 AAA_22
Motif
Other DBs
NCBI-GeneID: 16994614
NCBI-ProteinID: XP_005536790
UniProt: M1V8M4
Position
12:complement(367809..369302)
Genome map
AA seq 497 aa AA seqDB search
MEWDCWEQVPKHRAEQFQNICAALGLVIANHEGPECPTVQLFPTCTWIHLHGRACTGKTK
TLAAVRAMLERSEPSVGWLHVDCRTLVSGEQFMAAVAREVYAIAGARELSVPEPPARWNL
PLFMHTLLELLERLEERDVFLVLHLEGIEWLRGLDDFSRILASLRRLSFFADRCRGATTT
GALLRWSVLVESRLPPSRLFDPVESSYAPDWTLYFPPYDRAALRDILLQHCAFANAVQPR
EAERPQTPESSGRDLCADAFVDTLLDVCHDLTNDLNELSYWSDVLYPKYAKAWRPRPGHA
ASLAGAYSACLPYFRQAVAGVYARSTKQSKECIEKMNALHGQRTWREMLATESRLSNALV
LAGYLAAHIPPSHDRKLFEKAAGGVAGRKRRRGPRVHEETGRKTRSFSLERLQRLLEAIS
ERSMDAELRESDSLIRWSTTPPTGAVLAGLIGQGFFSSVTQARSAERQRLRCYVSRELAE
HVARKFDMNLSEYISET
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggactgctgggagcaggttccaaagcaccgtgctgagcagtttcaaaacatc
tgtgctgccctggggctggttattgcgaaccatgaggggccggagtgccccacggtccag
ctcttccccacgtgtacctggatccacctgcacggtagggcgtgcaccgggaagaccaag
actttggccgctgtgcgtgcgatgctagagcgttctgagccgtccgtaggctggcttcac
gtagactgccgaacacttgtgagcggcgagcagttcatggctgcagttgctcgtgaggtt
tacgcgatcgcaggtgcccgggagctgtctgttccggagccaccagcgaggtggaacctg
ccacttttcatgcatactttattagaactgctggagcggctcgaagagcgagatgttttc
ctcgttttgcacctggaaggtatagagtggcttcgtggtttggacgacttttcccgcatt
ctggcatcactcagacgcttgtcatttttcgcggatcggtgccgtggtgccacaaccact
ggcgcattgttacgctggagcgtgctcgtagagtctcgccttccaccctcacgtctattc
gatcctgttgagtcttcctatgcaccagattggacgctttacttcccgccctatgatcga
gcggcattgcgggatatcttgctgcaacattgtgcctttgcaaatgccgtccagcctcgt
gaagcggaacggccgcagacacccgagagctctggtcgagatttgtgtgcagatgctttc
gtggatacactactggatgtttgtcacgacctcacaaacgatttgaatgagttgtcctac
tggagcgatgtcttgtatccaaaatacgcaaaagcctggcgcccacgtcccggacacgcc
gcttcgctcgcaggtgcgtactcggcttgcttaccatattttcgacaagcggtcgcagga
gtctatgcacgttcgacaaagcaatcgaaagaatgtatcgagaagatgaacgctcttcat
ggacagcgtacttggcgggaaatgcttgctacagagtcccgcctctcgaatgctttagtg
ctcgccggataccttgctgctcatatcccgccaagtcatgatcgaaaactgtttgaaaaa
gcagcaggtggcgttgcggggcgtaaaaggcggcgcggcccacgcgtccatgaggaaacc
ggccgcaagaccaggtcattctcattagagcgtctgcaacgcctcctggaggccatatca
gaacgcagcatggatgccgagctcagagaatccgacagccttattcgatggagtacaaca
ccgccgaccggtgctgtactcgcgggtcttattggtcagggtttcttttcttccgtaacg
caggcacgttcagcggagcgccagcgactccgatgctacgtgagccgcgaactcgcggaa
cacgttgcccgcaagtttgatatgaacctatcggaatatataagtgaaacctaa

DBGET integrated database retrieval system