KEGG   Cyanidioschyzon merolae: CYME_CMO236CHelp
Entry
CYME_CMO236C      CDS       T00175                                 

Definition
(RefSeq) hypothetical protein
  KO
K14849  ribosomal RNA-processing protein 1
Organism
cme  Cyanidioschyzon merolae
Brite
KEGG Orthology (KO) [BR:cme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cme01009]
    CYME_CMO236C
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cme03009]
    CYME_CMO236C
Protein phosphatases and associated proteins [BR:cme01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CYME_CMO236C
Ribosome biogenesis [BR:cme03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    CYME_CMO236C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nop52
Motif
Other DBs
NCBI-GeneID: 16995726
NCBI-ProteinID: XP_005537620
UniProt: M1V9K6
Position
15:complement(612527..613549)
Genome map
AA seq 340 aa AA seqDB search
MAVAGTAETALARQLASSDAQVRNRALRKVERMLCQREPAPLSPKGMRRVWRALYYTLWF
ADTPSAINWTLERLCSWLGLAVDNWLYFEVMWETICRYWIEIDHLRLDKYYALLNRSLSA
ATSLCVDQVDHWRRLTGIVERVVFEPLVGTSADLDLEAAPAALGMALHVCDKWLELVLCQ
APGGLESLTLDTDSTHPVDIAVQPFLRLYLAPMERASATQQRNRKVLMRRAFERLWEPLV
RAPAAVPNQRDQLVYLSQPEHRQQLAERLFKLASRVEVPPYGRRFMYGCVRRLHTAVITS
AAATAAAAAAAAGPLFNDFDARIRKPRQRRRRRRQQRRRR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgcaggaactgcagagacagcgctcgcgcggcaactggcatcttccgatgcg
caagtgcggaaccgagcacttcgtaaagtagagcggatgttgtgccaacgtgaaccagca
ccactctctccgaaaggtatgcgaagggtctggcgagcgctctactacacactctggttc
gccgacacaccgtccgcgatcaactggaccctcgaaagactctgttcgtggttggggctc
gcggtggacaactggctctattttgaggtcatgtgggagacaatttgtcgatactggata
gaaattgaccatttacggctggacaagtactatgcgttgctaaacaggtcgctcagcgcc
gcaacctctttatgtgtggatcaggtggaccactggcgacgtctcaccggcattgtggaa
cgtgtcgtattcgaaccactggtagggacaagcgcggacctggatctcgaagcggcaccc
gcagcactcgggatggcgttgcacgtctgcgacaagtggctcgaactggtgctctgtcaa
gcgccgggcggccttgaatcacttaccctggacactgattcaacgcacccggttgatatc
gccgtacaaccattcttacgtctatatcttgcgccgatggagcgcgctagcgccacgcag
cagcgcaaccgcaaagtacttatgcgacgcgcctttgagagactgtgggaaccgctggta
cgtgccccagctgcagtaccaaatcaacgagaccagctcgtgtacttgtctcaaccagag
catcgtcagcaactcgccgagcgcttgttcaagctggcgtcgagagtagaggtgccacct
tatgggcgccgattcatgtacggctgcgttcgtagactgcataccgcagtcatcaccagt
gccgctgctactgctgctgctgctgctgctgccgcagggccactgtttaacgactttgat
gcacgtatacgaaagccgcggcaacgtcgacgtcgtcgtcggcagcagcggcggcggcgg
taa

DBGET integrated database retrieval system