KEGG   Cyanidioschyzon merolae: CYME_CMR183CHelp
Entry
CYME_CMR183C      CDS       T00175                                 

Definition
(RefSeq) WNK-like protein kinase
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
cme  Cyanidioschyzon merolae
Brite
KEGG Orthology (KO) [BR:cme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cme01001]
    CYME_CMR183C
   01009 Protein phosphatases and associated proteins [BR:cme01009]
    CYME_CMR183C
Enzymes [BR:cme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CYME_CMR183C
Protein kinases [BR:cme01001]
 Serine/threonine kinases: Other
  Wnk family
   CYME_CMR183C
Protein phosphatases and associated proteins [BR:cme01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CYME_CMR183C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 16996654
NCBI-ProteinID: XP_005538464
UniProt: M1VL77
Position
18:complement(442841..446224)
Genome map
AA seq 1127 aa AA seqDB search
MMGDDEQGEPSSVNGPFVSRRAELWDPVMPARRAVPADAGAAVPSAAACFDSTEAAPVLL
GVCSETTVTQEQSAPPVLSPVNGGQPGAGAMISGAAAGGMHRSGEAASAPAGIVTAPSAQ
SPSTEDNDDCFEERSPDGRFLRFPEVLGTGAYKTVYKGFDTDNGIEVAWNKLNIQRLTNQ
DTERVMNEVNILRSIQHPNIINLFAGWEVRDERGRVRGAHFITELMTSGTLKQYIAKVKM
IKVKVIRKWCRNVLEAIHYLHSCTPPIMHRDLKCDNIFINGNIGEVKIGDLGLSSVKDRA
SKCGYTVIGTPEFMAPELYDENYSEKIDIYAFGMCMLEMVSTEYPYAECENAGQIFKKVL
NGVLPEALSRMVECDLKRVILQCLASESQRPTALQLLNHPLFADWESDDGSLSNVDLMVS
PNSGRSRSSLEVPRSMTQFPDGDTNAAKQSLTSNLSPSPSSTTVSRLSMEHAPSRARARN
GDQTTPDAEAHSIVEHPATGKATSAGNITVNYIIAGRASHNASPTISALHDQSPNAKDSS
AVAGEERTKDAICGLLGVQQADAAAGALHQGPGRRRIFEGVDIDEAAAAPPTRPIVRVIG
RADESFRSILPAESGSISGTDTSAVPDSQHALSVDVTSVDATNRSGVNDRKLVYSGILVL
SVRIPVSGAVKRITFAMDPYRESAEQVAREMVEELNLDEAQAENIAQAIDRQLDLHLQPT
ATAGLPRTKPLPVETVSSIPTIRVVTTPLERLQEPPESEASPNLVSVPGAPAPTALRSSA
SPPVERTPAQTISGLSTITEISNSDTRAVHTAPKPSERAGNDRREAAQGLPPGAPLGTPD
CVAQVLRSSVAPTAPPLRPASSVPNAAGVPVVVVMETPPSDARENLSTDQTRCVHASEVD
TCHAASFLEGASVLYRPAQSAGAILDEGACLQTPVYESSALQPATSSDSAITNDMPAAGP
SRRATSEPASEVPLSGLHVVTVDESFMKSFVGKSSRTDECAPELTRDASWTHAHDDPRLT
GSERITRADSFSYDYDKVVDAKSTRSPSPLPTSPSARSSPSPSPSPPLDVHDLVQAMYGQ
MPALKRHSSSVAQVAGLVPVTSIDATSSTTDATGHRGQRRAPDRGQG
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgatgggagacgacgagcagggcgaaccttcttcagtgaatgggccgttcgtgtctagg
cgggcggagctgtgggaccctgtgatgccggctaggcgcgcggttccagctgatgccggt
gcggcggtgcccagtgccgcagcgtgttttgattcaacggaggcggcgccagttctgctt
ggtgtgtgctccgaaacaactgtcacacaggagcagtcggcgccgcctgtgttgagtcca
gtgaacggtggacagccgggcgctggggctatgatttctggtgccgcagccggcggtatg
catcgcagtggtgaagctgccagtgctccggctggcatagtgactgcgcctagcgctcag
agccccagcacggaagacaacgatgactgtttcgaggagcgctctcctgatggccgattc
ctcaggtttcccgaagttctcggaaccggtgcctataaaaccgtgtacaagggtttcgat
acagataacgggatagaggtggcctggaataagttgaatattcagagactgacgaatcag
gacacagagcgagtgatgaatgaagtgaatatcctgcgctctattcagcatccgaatatt
atcaatttgtttgcaggttgggaggttcgcgacgagcgcggccgggtccgaggagcgcat
tttatcacggaactaatgacgagtgggaccttgaaacagtatattgcgaaggtgaaaatg
atcaaggtcaaggttattcgcaagtggtgccgcaacgtcctcgaagcgatccattatctc
cactcgtgtacgccaccgattatgcaccgtgacctcaaatgcgacaatattttcatcaac
ggaaacattggcgaggtgaagatcggggatcttggtttgagttcggtgaaggatcgcgcg
agcaaatgcgggtacacggtcattgggacacccgaatttatggcgcccgaactgtacgat
gagaattacagtgaaaaaattgacatctatgcctttggcatgtgcatgctcgaaatggtc
agcacagagtatccgtacgcagaatgcgaaaatgcgggccagatcttcaagaaggttctc
aacggggtgcttccggaagcgctcagccggatggtcgagtgcgatctgaagcgcgtcatc
ctccagtgtttggcgtccgagtcgcagcgcccgacagcattgcagctgctcaatcacccg
ctcttcgccgactgggaaagcgacgatggttcactctcgaacgtagacttgatggtctcg
ccaaacagcgggcgctcgcgctcgtcgctggaagttccgcggtcgatgacgcaatttccc
gacggtgacacgaacgctgccaagcagtcgttgacatcgaacctgtcaccctcgccatca
tcgaccacagtgtcgcgactgtctatggagcatgcaccgtcgcgagcccgggcacgcaac
ggcgaccaaacgacacctgatgccgaggcgcatagcatcgtggaacacccagctactggg
aaagcaacatcggctggcaatattacggtgaactacatcatcgctggtcgtgcgtcgcac
aatgcatcgccgacgatttcggctttacacgaccagtccccgaatgcgaaggactcgagt
gcggtcgcgggagaagaacgcacgaaggacgctatctgcggtctccttggtgtccagcaa
gcagacgcggccgcgggtgcgttacatcaaggcccgggacgcagacgcatctttgagggc
gtggatatcgacgaggcggccgcagcaccgccaacgcgtcccattgtgcgtgttatcggc
cgagcggatgagtccttccgaagtatccttccggcggaatcgggtagtatcagcgggaca
gacaccagcgctgtaccggattcgcaacacgccctgagcgtagatgtcacctcggtcgac
gctacgaatcgttccggcgtcaatgacaggaaacttgtatactcggggattttggtgctt
tcagtgcgaattccagtgtctggcgcggtgaagcgcatcaccttcgccatggacccgtat
cgggagtcagcggagcaggtcgctcgcgagatggtcgaagaactgaacctcgacgaagcc
caagctgagaacattgcacaggcgattgatcgacaactcgatcttcatctgcaaccgaca
gcgaccgccggattaccgcgaaccaagccactgcccgtcgagacggtctccagcataccc
acgattcgagtcgttaccaccccgctggagcgtcttcaagagccgcccgagtcggaggcg
agccccaatctcgtcagtgtacctggagcgccggcgccaacggctcttcgttcgtctgcg
tctccgcctgttgagagaacacccgcacagacgatttcgggattatcgacgatcacagag
atttcgaacagcgacactagagcggtgcatacggcaccgaagcccagtgagcgagcgggc
aacgacaggcgcgaagccgcacagggcttgcctcctggtgcgcctctgggcaccccagat
tgtgttgcccaagtgctacgcagcagcgttgcgccaactgcaccacccctgcgaccggca
agcagtgtacccaatgccgctggcgtgcctgttgtcgttgttatggaaacgccaccgtcg
gatgcgcgggaaaatctcagcacggatcagacgcgatgcgtgcacgcctctgaagtagac
acgtgtcatgcggcatcgtttttggagggcgcctctgtgctctatcgcccggctcaatcc
gcaggcgccattctcgatgaaggtgcttgtttgcagacgccagtgtatgaaagttcggcg
ctgcaaccggcgacgagcagcgactcggcgataacgaatgatatgcctgctgcaggtccg
tcgcggagggcaacctcggaaccggcgagcgaggttccgctcagcggcttgcatgttgta
accgtagatgagtcgttcatgaaatcgttcgttgggaaatcttcacgaaccgacgagtgt
gctccagagctgaccagagacgcgtcatggacacacgcacacgatgatcctcggttgacc
gggagcgagcgaatcactcgtgcagattccttttcctacgactacgacaaggtggtggat
gcgaaatccacacgttcaccatcaccattgccgacatcgccgtcagcacgatcgtcgccg
tcgccgtcgccgtcgccgcccctggatgtgcatgatctggtacaggccatgtacggacag
atgccggcactgaaacggcattcgagttcggttgcacaggttgccggcctggtgcctgtt
acctcaatcgatgccacgtcgtcgaccacggatgccaccggtcaccgtggacagcgacgg
gcgccggaccgcgggcaaggctag

DBGET integrated database retrieval system