KEGG   Cyanidioschyzon merolae: CYME_CMR234CHelp
Entry
CYME_CMR234C      CDS       T00175                                 

Definition
(RefSeq) DNA replication licensing factor MCM7
  KO
K02210  DNA replication licensing factor MCM7 [EC:3.6.4.12]
Organism
cme  Cyanidioschyzon merolae
Pathway
cme03030  DNA replication
Brite
KEGG Orthology (KO) [BR:cme00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CYME_CMR234C
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cme01009]
    CYME_CMR234C
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cme03032]
    CYME_CMR234C
Enzymes [BR:cme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CYME_CMR234C
Protein phosphatases and associated proteins [BR:cme01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CYME_CMR234C
DNA replication proteins [BR:cme03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    CYME_CMR234C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCM MCM_OB MCM_lid MCM_N AAA_5 Mg_chelatase AAA_3 Mg_chelatase_C AAA_lid_2
Motif
Other DBs
NCBI-GeneID: 16996687
NCBI-ProteinID: XP_005538501
UniProt: M1V6T0
Position
18:583932..586424
Genome map
AA seq 830 aa AA seqDB search
MATELAYRLPFDSLNLGSNPQQSLRALGGSQPSDSRGGAGRSRSSPANTYSTDVEVLVHF
FQTFVDDREANPSLGSDSLDRDADGTRHTAAGSEAAEEPAALGERQNLRGVAPKYLRHLQ
KIVDRDSKILAVELDDLFTAHEETLAMRIQLNTKRYIEILSQAADAIIATLRPSRLLALD
TLDLLMQQREQNEQENRLEDQELFGNAGAGAGAADEDPYKRIPPLLARRYQVQLVPASED
KPFRIRDVRAEHVGRLVQVSGIVTRVLDVRPLVQVAIYVCDACGTEYYQPIPGRQYMPLF
FCSKQECMRSATGGGRLIPQYRAFKYSKFQEIRIQEPAHDVPVGSIPRTLTVLLQGELSN
ACAAGDHITVAGIFLPTLVSGFRAFKQGLLSDTYLEATFIRQQKRDYKDYQREIARNQLI
QARIAELASTAGVYDRLARSIAPEIYGHEDVKKALLLQLVGAPTRELADGMRLRGDIHVC
LMGDPGVAKSQLLRYICNVAPRGVYTTGKGSSGVGLTAAVLRDSNTGDVTLEGGALVMAD
CGIACIDEFDKMDEIDRTYIHEVMEQQTVSIAKAGITTSLNARAAVLAAANPVQGRYNRR
RSAAENINMPAALLSRFDLLFLMLDAPDQDKDLALARHVTYVHRTGEAPELGFEPASPDL
LRAYVAQARQCVPVVPSELTAYVVEHYVALRADDKQRRWLPRGHTTARTLLSILRLAQAL
ARLRFSNLVSREDIDEAVRLLNCSKASLDDPSEAGGHRNLHELDATTRIYLLIRDHAADR
GERSVPIADILEQALQQGFTSQQFYTALSEYEDINIWSVDSNRTRITFTV
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggccactgaactagcataccgactgccatttgatagtctgaacttgggtagtaaccct
cagcaaagcttgcgggcgctcggtggctcacaaccttcagactctcgcggtggggcgggc
cggagtcgtagcagtcctgcgaacacgtactcgacggacgtggaagtcctcgtccacttc
tttcagacttttgtggatgatcgtgaggcaaacccgagcttgggcagcgacagtctggac
agggatgccgacgggactcgccacacggccgctggctccgaagcggctgaggagcccgct
gcgctaggcgagcggcagaacttgcgaggcgtcgcgccaaagtacctgcgccatctgcaa
aaaattgtcgaccgcgactccaaaatacttgctgttgagctggatgacttgttcacggct
catgaggaaacgctcgctatgcgcatccagctgaacaccaagcggtacattgaaatcttg
tctcaggctgcggacgccattatcgccacgttgcgaccgagtaggctgctggctttggac
actctagacctattgatgcagcagcgggagcaaaacgaacaggagaaccgtctcgaagac
caggagcttttcggtaatgccggtgctggtgctggtgcagcagacgaagatccctacaag
cgcattcccccgcttttggcgcggcgctatcaggtgcagctggtccctgcatcagaggac
aaaccgttccggatccgtgatgtgcgagctgagcatgttggccggcttgtgcaagtcagt
ggcatcgtaacgcgcgtgctcgatgtgcgcccactcgttcaggttgccatttatgtctgc
gatgcctgcggtacggagtattaccaaccgataccgggacgacaatatatgccccttttc
ttttgctcaaagcaagaatgcatgcgttccgccaccggaggcgggcgtctcattccccag
tatcgtgctttcaaatatagcaagttccaagagattcgcattcaagagcccgcgcacgat
gttcccgttggtagcattccacgaacgttaactgttctgttgcaaggcgaactctcgaat
gcttgcgcagctggcgaccacattacggtggccggtatttttttgccaacgctcgtgtct
ggctttcgcgcgttcaagcagggactcctgtcggacacctacctcgaagccactttcatt
cggcaacaaaaacgggactacaaggattatcagcgggaaatagcccgcaatcagctcatt
caggctcggattgctgaactcgccagtaccgctggagtttatgatcggctcgcgcgctcc
attgctccagaaatctacgggcacgaggatgtcaaaaaagcgctccttctgcaactggta
ggcgcaccgacccgtgaacttgctgatgggatgcgcctgcgcggtgatatacacgtatgc
ctcatgggcgatcccggtgtcgccaagtcgcagctgcttcgctacatctgcaatgtagca
ccgcgaggcgtctacactacgggcaagggctcgagtggtgtgggcctcaccgcagccgtt
ctccgtgactccaataccggtgatgtgacgttagaaggcggcgccctcgtcatggctgac
tgcggcatcgcatgcatcgatgaattcgacaaaatggatgagattgatcgcacctatatc
catgaggtcatggagcaacagacagtctcgatcgccaaagctggtattacgacttcgctg
aatgcacgggcggccgttctcgcagcagcgaatccagttcagggccgttataatcgacga
cgctcagccgccgaaaatatcaacatgccagcagcactgctgtcgcgctttgatctgttg
ttcctcatgctcgatgcacccgatcaggacaaggacctggctcttgcccgacatgtgacg
tacgtgcaccggacgggcgaggccccagaactcggattcgaaccagcgtcacccgacttg
ctgcgagcctacgttgcgcaggctcgacagtgtgtgcccgtagtaccgtccgagttgacg
gcctatgtcgtagaacactacgtagcgctacgcgctgatgataagcagcgccgctggttg
cctcgcggccacacgactgctcgcacgttgctgagcatcctacgacttgcacaggcactc
gctcggctgcgcttttccaaccttgtttcgcgcgaagatattgatgaagctgtgcgactg
ctcaactgctccaaggcctctctggacgatccgagcgaggcaggtggccatcggaacttg
cacgagctggacgcgacaacgcggatctatctactcatccgcgaccatgctgctgaccgg
ggcgagcgctcggtgcccattgcggacatcctcgagcaggccctgcagcaaggtttcact
agccaacagttctacaccgcgctgagtgaatacgaagacatcaatatctggtcggtggac
tcgaaccgtacccgcattacattcacggtgtga

DBGET integrated database retrieval system