KEGG   Cyanidioschyzon merolae: CYME_CMS286CHelp
Entry
CYME_CMS286C      CDS       T00175                                 

Definition
(RefSeq) cytochrome-b5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cme  Cyanidioschyzon merolae
Pathway
cme00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:cme00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CYME_CMS286C
Enzymes [BR:cme01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CYME_CMS286C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 DUF3180
Motif
Other DBs
NCBI-GeneID: 16997378
NCBI-ProteinID: XP_005538914
UniProt: M1VM09
Position
19:724593..725465
Genome map
AA seq 290 aa AA seqDB search
MFTFLASSTIETNTSFASLVLVSVVVLASAWLWHRYSNRAGERAPALKPDTFTRFRLVAK
TVVSHNTRLFRFALPFPDQLLGLPPGQHVVLRARVPDAEEPILRPYTPVSKPETRGYFEL
LVKVYPAPSGKMGRYLDALEPGRDFVEARGPSGTFSYQRNMVAELGMIAGGTGITPMWQL
IQVILSDPSDKTRIKLIFANVKEEDILLRSAIDAAAAQYAERFTRFYVLNEPPAEWSMGI
GFVTQEHIRSFIGLPDASKMVLICGPPPMNKAMREHLEALGYDKAAVFRF
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgttcacgtttttggcctcatcgacgatcgaaacgaatacgtcgtttgcatctttggta
ctggtgagcgttgtcgtgctggcaagcgcttggctatggcaccggtatagcaaccgcgct
ggcgagagagcacctgcccttaagcctgatacgttcacccggttccgtctggtagccaaa
accgtcgtgtcccataacacgcgtctgtttcggttcgcgcttccgttccctgatcaacta
cttggtctgccgccagggcagcacgttgtgctacgtgcgcgcgttcctgacgccgaggag
ccaattctccgaccgtacacaccggtgtcgaaaccggaaacacgcggttacttcgagttg
ctcgtgaaggtctatcctgcgcctagcggaaaaatgggtcgctatctagacgctctggaa
ccgggaagagactttgtggaagcacgaggcccaagcggaaccttcagttaccaacggaac
atggttgcagaacttggtatgatcgcaggcggcacggggatcacgcccatgtggcaattg
attcaagtaatcctgagtgacccttctgataagactcgaatcaaactgatctttgcaaat
gtgaaagaagaagatattttattgcgttctgcgatcgatgctgcagcagcgcaatacgcg
gagcgattcactcgtttttacgtcctaaacgagccgcctgctgaatggagcatgggcata
ggtttcgttacgcaagagcacatccgaagttttataggtctcccggatgcgagcaagatg
gtgctcatctgcggcccgccgccgatgaacaaggcaatgcgcgagcatctcgaggccctt
ggctacgacaaagccgctgtgtttcggttctaa

DBGET integrated database retrieval system