KEGG   Cyanidioschyzon merolae: CYME_CMT559CHelp
Entry
CYME_CMT559C      CDS       T00175                                 

Definition
(RefSeq) similar to SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily B
  KO
K11648  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
Organism
cme  Cyanidioschyzon merolae
Brite
KEGG Orthology (KO) [BR:cme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cme01009]
    CYME_CMT559C
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cme03021]
    CYME_CMT559C
   03036 Chromosome and associated proteins [BR:cme03036]
    CYME_CMT559C
Protein phosphatases and associated proteins [BR:cme01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CYME_CMT559C
Transcription machinery [BR:cme03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     CYME_CMT559C
    SWI/SNF complex
     CYME_CMT559C
Chromosome and associated proteins [BR:cme03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    CYME_CMT559C
   PBAF complex
    CYME_CMT559C
   SWI/SNF complex
    CYME_CMT559C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNF5 GATA zf-C4_ClpX
Motif
Other DBs
NCBI-GeneID: 16997645
NCBI-ProteinID: XP_005539508
UniProt: M1VIN6
Position
20:1411644..1412678
Genome map
AA seq 344 aa AA seqDB search
MVQSVNLDTGQAEEFELKQGQCGAAQEPLIPIRIDVQWNDARVVDAFLWNQYEERLTPET
FAPHLLRDLQQPMELANGVASAIREQIEQYSPFEHELFADRSELRLLFTLDVRIGNIQLQ
DTFEWDALSFESDPEQFSRMLCRELGLGTEFSTAIAHAIREQLQDVWAGVAYSQKSILES
VHPRITIRDGEDWELPGPAVRVLSKEELEEVERREDRSARAMRRSQRKSGLSWGLAPAPT
LRERSVDSTVFFGPRQAVAEERPKRRRNQNPVDSEGRPVVACSHCGRHPSKTPLMRVGPR
GLKNEICNSCGLYYRKYGELPTHYKGYPIGPGYPPPPGSQEHDA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagtcggtaaacctggatacggggcaagcggaggaattcgagttgaagcagggg
cagtgcggtgccgcacaggaaccgctcataccaatccgcatcgatgtgcagtggaacgat
gcccgtgttgtcgatgcctttctttggaaccaatatgaagaacgcctcacaccggagacg
tttgccccacacctgctccgggatctgcagcaacctatggagcttgcaaacggtgttgcg
tccgccattcgcgagcagatagagcagtactctccctttgaacacgagctattcgcggat
cgttccgagttgcgcctgctctttaccttggatgtgcgaatagggaatatccagctacag
gatacctttgagtgggatgcgctctcattcgaaagcgatcccgagcagttttcgcggatg
ctctgtcgagaactgggccttggaacagagtttagcaccgccatcgcccatgcgattcgt
gaacagttgcaggacgtttgggcgggtgtcgcttactcccaaaaaagcattctggaatcc
gtgcatccgcgtataacgattcgggatggcgaagattgggagcttccgggtcccgcggtg
cgcgtgctctccaaggaggaactcgaagaggtggagcggcgtgaggatcgcagtgctcgc
gccatgcgtcgcagtcagcgcaaatccgggctgagctggggcctggccccagcgccaacg
ctccgggagcgctccgtggacagcactgtgtttttcgggccgcggcaagccgtggccgaa
gagcgccccaaacggcgtcgcaaccagaatcctgttgactctgagggtcggcccgtcgta
gcctgcagccattgtggtcgacatccgtcaaaaacgcctttaatgcgagttggaccacgt
ggtctcaagaacgaaatctgcaatagttgtggcctgtactatcgcaaatatggagagctt
cccacgcattataagggctatcccattgggcctgggtatccgccacctcctggaagtcag
gaacatgatgcataa

DBGET integrated database retrieval system