KEGG   Caminibacter mediatlanticus: FE773_08275Help
Entry
FE773_08275       CDS       T05985                                 

Definition
(GenBank) RNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
cmed  Caminibacter mediatlanticus
Brite
KEGG Orthology (KO) [BR:cmed00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cmed03009]
    FE773_08275
Enzymes [BR:cmed01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     FE773_08275
Ribosome biogenesis [BR:cmed03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    FE773_08275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: QCT95186
UniProt: A0A4P9DTE2
Position
complement(1536870..1537628)
Genome map
AA seq 252 aa AA seqDB search
MKKEKAYILLAKQEGISNRAAKELIDRGLVYTHDRKIKIARGLLPVNIRFKIEKIPNPKV
IFEDNNLLVIDKPPYITSEEISKRFKYPLLHRLDKETSGILVLTKNEDFRKKAIEEFKNK
NVYKEYLAWVSGIVAEPMKIDFPIKVIKTKSGAFAKVSSDGEEAITEIEPILAFRTKSKI
KAIIHTGKTHQIRAHLKAIDHPIIGDEKYGGEPYKRVMLHHYKFKIFDYNFESPEPRDFK
MQEQNDNKKRKK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagaaaaagcatatattttgcttgctaaacaagagggcatctcaaatagagca
gcaaaagaattaatagatagagggcttgtttatactcatgatagaaaaattaaaattgca
agaggacttttacctgtaaatataagatttaaaatagaaaaaatacctaacccaaaagtt
atatttgaagataataatttattagtaattgataagccaccttatattacaagtgaagaa
attagcaaaagatttaaatatcctcttcttcatagactggataaagagacaagtggtatt
ttagtgttaacaaaaaatgaagattttagaaaaaaggctattgaagaatttaaaaataaa
aatgtatataaagagtatttagcttgggttagtggtattgtagctgagcctatgaaaata
gattttccaattaaagttattaaaacaaaaagtggtgcttttgctaaggttagtagtgat
ggagaagaagctataactgagattgagccaattttagcatttagaacaaaatctaaaata
aaagcaataattcatacaggaaaaactcatcaaattagagctcatctaaaagcaatagac
catccaataattggagatgaaaagtatggaggagagccttataaaagagttatgcttcat
cattataaattcaaaatttttgattataattttgaatcaccagagccaagagattttaaa
atgcaagaacaaaatgataataaaaaacgcaaaaaatag

DBGET integrated database retrieval system