KEGG   Chlamydia muridarum Nigg3 clone G28.38.1: NC81_00340Help
Entry
NC81_00340        CDS       T03405                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cmg  Chlamydia muridarum Nigg3 clone G28.38.1
Brite
KEGG Orthology (KO) [BR:cmg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    NC81_00340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AIT91191
UniProt: A0A070A2N0
Position
73311..74591
Genome map
AA seq 426 aa AA seqDB search
MWWLLVCVVIGGFYTAWNIGANDVANAVGPSVGAGVLTLRQAVLIAAVFEFLGAVVLGDR
VIGTIESGLVAPADHVLSSQDYVFGMTAALFATGVWLQIASFFGWPVSTTHAIVGGVLGF
GIILKEDAVIYWDSCARIFVSWLASPIIGGYFAFLIFSFIRKAILYKRDPVSAMVRIAPF
LSAIIIFALGLILILSGAVARVVAFPVAFRVVCGLVVFAFAFTIWGVHFFKLAVLPQKVG
PGTLLDRLLSKSTDYGRQYLVVERIFAYLQIVIACFMSFAHGSNDVANAIAPVAGIYRAL
YPQSYSPKVLFIFMSLGGLGLVFGLATWGWRVIDTIGKKITELTPSRGFSVGMSSAITIA
AASAFGFPISTTHVVVGAVLGVGLARGLQAINLRIIKDIVLSWFVTVPAGAALSIMFFLL
LRAVFC
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggctgctggtttgtgtggttataggcggattctacactgcttggaacataggc
gctaatgatgtagcgaatgctgtggggccaagtgtaggggctggcgtgttgactttgcga
caggctgttctcattgctgcggtttttgaattccttggagctgtggtattaggggatcga
gttatcggtaccattgaaagtggtttagtggcgccggccgatcatgttctgtcttcccaa
gattatgtctttggaatgacagcagctctttttgctactggtgtttggttacagatagca
tctttttttgggtggccagtatcaacaacccatgctattgtgggaggcgttttaggcttt
ggaatcatccttaaagaggatgctgttatctattgggattcctgtgctcgaatatttgtc
agctggttagcctctcctattattgggggatatttcgcttttcttattttctcttttatt
cgaaaagccattctttataaaagagatccagtttctgccatggtgcgtatagctccgttt
ctatctgctattattatttttgctttaggtttgatccttatccttagtggagcagtggct
cgtgtagtggcttttcctgtagctttccgcgttgtttgtggattagttgttttcgctttt
gcctttacgatttggggagtgcacttttttaaactggccgttctccctcaaaaagtgggg
ccaggaacattgttagatcgactgttatccaaaagtacagattatggacgacagtacctt
gttgttgagcgtatttttgcttacttacaaatagtcattgcgtgctttatgtcttttgcc
cacgggtctaatgatgttgccaatgctatagctcctgttgctggtatttatcgggctcta
tatccgcaaagttactctccgaaagttctctttatattcatgtctctagggggcttaggt
ttagtctttggattggcaacatggggttggcgtgtaattgatactattgggaaaaaaatc
acagagcttacgccatcgagagggttctctgtaggaatgagctcggctatcactattgca
gcagcatctgcttttggattccctatatcaactacacatgttgttgtgggtgccgtattg
ggggtagggttagcaagagggctgcaagctatcaatctacggattattaaagacattgta
ctctcgtggtttgttacagtgcccgcaggagcagctctttccatcatgttttttttgtta
ttacgcgcagtattttgttaa

DBGET integrated database retrieval system