KEGG   Chlamydia muridarum Nigg3 clone G28.38.1: NC81_00650Help
Entry
NC81_00650        CDS       T03405                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
cmg  Chlamydia muridarum Nigg3 clone G28.38.1
Pathway
cmg00860  Porphyrin and chlorophyll metabolism
cmg01100  Metabolic pathways
cmg01110  Biosynthesis of secondary metabolites
Module
cmg_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cmg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NC81_00650
Enzymes [BR:cmg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     NC81_00650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AIT91244
UniProt: A0A069ZQL3
Position
complement(146952..148325)
Genome map
AA seq 457 aa AA seqDB search
MFNINFNFLKGLHQPAPRYTSYPTIVDWEASQDYGYTALKNLADEHQPLSLYFHIPFCQS
MCLYCGCSVVLNRKEEIVDHYIESLIQEMRLTFSLLGGKKPVSRIHFGGGTPSRLSRAQF
THLFTHIHQFFDLSNIEELAIEFDPRSLREDADKPLFLQNLGFNRVSLGIQDTQWEVQEA
VRRRQSYEESLLAYKQFRDLNFTGINIDLIYGLPKQTQSSFKQTIQHILDMRPDRLALFS
FAHVPWVKPHQKALRTKDLPSMEEKFAIYSQSRQALIQEGYQAIGLDHFSLPDDPLTIAL
KNKTLIRNFQGYSLPPEEDLLGFGLSATSFIRGIYLQNSKDLREYSTTIHSGKLATVKGK
ILSQDDKIRKWVIHTLMCSFSLSKLEFEQLFHERFDLYFADSYDRLCGMESAGLIRQDSS
SLQVTPLGELFVRVIATAFDYYFLKNVAEKPIFSKSI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacatcaatttcaacttcctaaaagggcttcatcaaccggcccctcgctacacg
agttatcccactatcgtcgattgggaagcatcccaagattatggttatacagccttaaaa
aacctggctgatgagcaccagcctctttctttatacttccacatccccttctgccaatct
atgtgcctttattgcgggtgctctgttgttttaaatagaaaagaggagattgtggatcat
tacatagaatccttgattcaagaaatgcgtctcacattctctttgttaggagggaaaaag
cctgtttctagaattcactttggaggaggaactcctagtcgtctatcacgagctcaattc
acacacctatttactcatattcatcaattttttgatctctctaatatcgaagaacttgct
attgaatttgatccacgtagcctacgagaagatgcagataaacccctatttcttcagaac
cttggatttaatcgtgtcagccttggaatccaagatactcaatgggaagttcaagaggcc
gtccgtagacgccaatcctatgaagaatccctcttggcctataaacaattccgtgatctg
aatttcacaggtatcaatattgatcttatttatgggcttcctaaacaaacgcaatcgagt
ttcaaacaaaccattcaacatattttagatatgcggcctgatcgcttagccctattctct
tttgcacatgtgccatgggtcaagcctcatcaaaaagctttacgaacaaaagaccttccc
tctatggaagagaaatttgcgatttattctcaatctcgacaagcccttatccaagaagga
taccaggctattggccttgatcatttttctcttcctgatgatcccctaactattgcactt
aaaaacaaaacccttattcgaaattttcaagggtattcccttcctcctgaagaagatctt
ttaggatttggcttgtcagcaactagctttattcgaggcatttacttacagaattctaaa
gatcttcgtgaatattccacgaccatccattccggaaaacttgctactgtaaaaggaaaa
atcctttctcaagacgataaaatccgcaaatgggtcattcatactctgatgtgttctttt
tctttatctaagctcgagtttgagcaacttttccatgaacgatttgatctatactttgct
gatagctacgatcggttatgcgggatggaaagtgctggcctaatccgccaagactcttcc
tctttacaagtcactcctcttggagagctttttgtacgagtaattgctacggcttttgat
tattactttctgaaaaacgttgcagaaaaaccgattttttcaaaatccatatga

DBGET integrated database retrieval system