KEGG   Clavibacter michiganensis subsp. insidiosus: VO01_01695Help
Entry
VO01_01695        CDS       T03862                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
cmh  Clavibacter michiganensis subsp. insidiosus
Pathway
cmh00053  Ascorbate and aldarate metabolism
cmh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    VO01_01695
Enzymes [BR:cmh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     VO01_01695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 RmlD_sub_bind GDP_Man_Dehyd NmrA Polysacc_synt_2 Tachykinin
Motif
Other DBs
NCBI-ProteinID: AJW78016
UniProt: A0A0D5CEF4
Position
349349..350149
Genome map
AA seq 266 aa AA seqDB search
MATITITGGSGRIATSIRPLLVAAGHELRLLDVVAPPTPLASGETSAIVDTTDVVACTEA
FRGSDLVVHLAAHAAERPWEAIQAVNNDGAHAVHEAVVRAGVPRILAASSIHAVGFLPAT
EAAREDVPAPRPDTFYGLSKVLLEGLGSMYADRHGHVVVSVRIMTAEPEPSQARSVSTWL
SPGDAARLVEAVLRWDEPGHRIVWGVSRNTRRWVSLAAGEAIGYHPEDDAEVFAHRFPEL
GADTSPPAGVLLGSIFTEVELGSDMG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggccacgatcacgatcacgggaggatccggccggatcgccacgagcatccgcccgctg
ctcgtcgccgccgggcacgagctgcggctgctcgacgtggtggccccgccgacgccgctc
gcgtcgggggagacctcggccatcgtcgacacgacagacgtcgtcgcgtgcacggaggcg
ttccgcggatccgacctcgtggtgcacctcgcggcgcacgcggccgagcggccgtgggag
gcgatccaggccgtgaacaacgacggcgcgcacgcggtgcacgaggcggtcgtgcgggcg
ggggtgccgcggatcctcgcggccagctccatccacgcggtcggcttcctgcccgcgacc
gaggccgcgcgcgaggacgtgcccgcgccccggcccgacacgttctacggcctgagcaag
gtgctgctcgaggggctcggcagcatgtacgccgaccggcacgggcacgtcgtggtgagc
gtgcggatcatgacggccgagccggagccgtcgcaggcccgcagcgtctcgacctggctc
tcgccgggggacgcggcgcggctcgtcgaggccgtgctgcggtgggacgagcccggccac
cgcatcgtgtggggcgtctcccgcaacacgcgccgctgggtgtcgctcgcggcgggcgag
gcgatcggctaccacccggaggacgacgccgaggtgttcgcgcaccgcttccccgagctc
ggcgcggacacctcgccgcccgcgggcgtgctgctcggctcgatcttcacggaggtcgag
ctgggctccgacatggggtga

DBGET integrated database retrieval system