KEGG   Clavibacter michiganensis subsp. insidiosus: VO01_02750Help
Entry
VO01_02750        CDS       T03862                                 

Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
cmh  Clavibacter michiganensis subsp. insidiosus
Pathway
cmh00860  Porphyrin and chlorophyll metabolism
cmh01100  Metabolic pathways
cmh01110  Biosynthesis of secondary metabolites
cmh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cmh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VO01_02750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cmh01007]
    VO01_02750
Enzymes [BR:cmh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     VO01_02750
Amino acid related enzymes [BR:cmh01007]
 Aminotransferase (transaminase)
  Class III
   VO01_02750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AJW78183
UniProt: A0A0D5CEV7
Position
555620..556987
Genome map
AA seq 455 aa AA seqDB search
MTHSQDLFDRARDVIPGGVNSPVRAFGSVGGTPRMMVKAAGPYVTDADGVEYVDLVNSWG
PAILGHVRPEVVRAVQDAAALGLGFGATTPAETELAELVTERVRVAGVDGSPDRRPIEKL
RLVSTGTEATMTAIRLARGFTGRDLLVKFAGHYHGHSDSLLAEAGSGVATLALPGSAGIP
AAIAAQTIVVPYNDLGAVRAVIAEHGPRIAAVITEAAAANMGVVPPLPGFTAELARIAHD
NGSLLISDEVLTGFRVHPAGYWGLDNAGLAADHPDAWTPDLVTYGKVIGGGLPVAALGGR
ADVMDHLAPLGPVYQAGTLSGNPVAVAAGLTTLRLADADVYRALDIAADILIYAVELAFD
RAGLAYSVQRAGSLFSFTFGTPPEHGITDYATVQAQETWRYPAFFHSMLDQGVSLPPSVF
EAWFVSAAMDEASLDRVIRALPAAARAAAAATPPA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgacccactcccaggacctcttcgaccgcgcccgcgacgtcatccccgggggagtgaac
tcgcccgtccgcgcgttcggctccgtcggcggcacgccgcgcatgatggtgaaggcggca
ggcccgtacgtgaccgacgccgacggcgtggagtacgtcgacctcgtcaactcctggggc
cccgcgatcctcggccacgtccgccccgaggtcgtgcgggccgtgcaggacgccgccgcg
ctcggcctcggcttcggcgcgacgacgcccgcggagacggagctcgccgagctcgtcacc
gagcgcgtgcgcgtcgcgggcgtcgacggatccccggaccgccgcccgatcgagaagctc
cgcctcgtgtcgaccggcaccgaggccaccatgaccgcgatccgcctcgcccgcgggttc
acgggccgcgacctcctcgtgaagttcgccggccactaccacggccactccgacagcctc
ctcgccgaggccggctccggcgtcgcgacgctggcgctgccgggctccgcggggatcccc
gcggccatcgccgcgcagaccatcgtggtgccctacaacgacctcggcgccgtccgcgcc
gtcatcgccgagcacgggccccgcatcgccgccgtgatcacggaggccgccgccgcgaac
atgggcgtcgtgccgccgctgcccggcttcaccgccgagctcgcgcgcatcgcccacgac
aacggatccctgctcatctcggacgaggtgctcacgggcttccgcgtgcacccggccggc
tactggggcctcgacaacgccggcctcgcggccgaccaccccgacgcctggacgcccgac
ctcgtcacgtacggcaaggtcatcggcggcggcctccccgtcgccgcgctcggcggccgg
gccgacgtgatggaccacctcgcgcccctcggccccgtctaccaggcgggcacgctgtcc
gggaacccggtcgcggtcgccgcgggcctcacgaccctccgcctcgcggacgccgacgtg
taccgcgcgctagacatcgccgcggacatcctcatctacgcggtcgagctcgccttcgac
cgcgccggcctcgcctactcggtgcagcgcgcgggcagcctcttcagcttcacgttcggc
acgccgcccgagcacgggatcaccgactacgccacggtgcaggcgcaggagacctggcgc
tatccggccttcttccactccatgctcgaccagggcgtcagcctgccgccctcggtgttc
gaggcgtggttcgtgtcggccgcgatggacgaggcgtcgctcgaccgcgtgatccgcgcc
ctcccggccgccgcccgcgcggccgctgcggcgaccccgcccgcgtag

DBGET integrated database retrieval system