KEGG   Clavibacter michiganensis subsp. insidiosus: VO01_08915Help
Entry
VO01_08915        CDS       T03862                                 

Definition
(GenBank) transferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
cmh  Clavibacter michiganensis subsp. insidiosus
Pathway
cmh00430  Taurine and hypotaurine metabolism
cmh00460  Cyanoamino acid metabolism
cmh00480  Glutathione metabolism
cmh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    VO01_08915
   00460 Cyanoamino acid metabolism
    VO01_08915
   00480 Glutathione metabolism
    VO01_08915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cmh01002]
    VO01_08915
Enzymes [BR:cmh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     VO01_08915
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     VO01_08915
Peptidases and inhibitors [BR:cmh01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   VO01_08915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AJW79230
UniProt: A0A0D5CIW0
Position
complement(1866468..1868279)
Genome map
AA seq 603 aa AA seqDB search
MTFRAPDAFTTRPTLRGTFGMSASTHWLASGTGQAVLERGGNAFDAAVASAFVLHVVEPH
LNGPGGDMTAVVHVAGEDAPKLLMGQGSAPAAATPERFRQEGLDRVPGAGALAAAVPAAV
DAWLLLLRDHGTWELADVWAFAIGYARDGHPMLERVARTIGGVAEVFRDHWPASAAFWMP
DGRVPDADALVRNPPWAAAMERILAEASTAAGPDATREQRIEAARTVWAEGFVAEEMVAS
VQDPHRHSTGADHVGLLTAADLAGSRASWEDAVSVEFRGLRIWKTDAWGQGPALLQALMI
LDGFTDEEIDPATAAGIHRVIEAQKLALADREAYYGDAVPGGAPLDVLLSPEYAAERRAL
ITDGASHELLPGRVDGVEPFLSPLVVEGDAPASAGGTGEPTVSRAGETRGDTCHLDIVDR
WGNMISATPSGGWLQSSPFIPSLGFCLGTRLQMTWLEPGGPSSLVSGRRPRTTLTPTLIT
RDGEPVEALGSPGGDQQDQWQLPYLLRTIVGGFSPQQAVDAPTFHTTSVPGSFWPRTWMP
GGLVVEGRVGDDVITDLRARGHEVEVVGDWTLGRLSAVTRDPATGLLGAAANPRGAQGYA
VGR
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
gtgacattccgcgcgcccgacgcattcaccacccgacccacgctccgcggcacgttcggc
atgagcgcctccacgcactggctcgcgtccggcaccggccaggccgtgctcgagcgcggc
ggcaacgcgttcgacgccgcggtcgcgagcgcgttcgtgctgcacgtcgtggagccgcac
ctcaacggtcctggcggcgacatgaccgccgtcgtgcacgtcgcgggggaggacgcgccg
aagctgctcatggggcagggatccgcgcccgccgccgcgacgcccgagcgcttccgccag
gagggcctcgaccgggtccccggcgccggcgcgctcgccgcggccgtgcccgccgccgtc
gacgcgtggctgctgctgctgcgcgaccacggcacgtgggagctcgccgacgtgtgggcc
ttcgcgatcgggtacgcgcgcgacgggcacccgatgctcgagcgcgtggcccgcaccatc
ggcggcgtcgccgaggtgttccgcgaccactggcccgcgtccgccgcgttctggatgccg
gacggccgcgtgcccgacgccgacgcgctcgtgcgcaatccgccgtgggcggcggcgatg
gagcggatcctcgccgaggcgtcgaccgccgccggtccggacgcgacgcgggagcagcgc
atcgaggcggcgcgcacggtctgggccgagggcttcgtcgcggaggagatggtcgcgagc
gtgcaggacccgcaccggcactccacgggcgccgaccacgtggggctcctcaccgccgcg
gacctcgccggctcgcgcgcgtcgtgggaggacgccgtgtcggtcgagttccgcggcctc
cggatctggaagaccgacgcgtggggccaggggccggcgctgctgcaggcgctgatgatc
ctcgacgggttcacggacgaggagatcgacccggcgacggccgccgggatccaccgcgtc
atcgaggcgcagaagctcgcgctggccgaccgcgaggcgtactacggcgacgccgtgccg
ggcggcgcgcccctcgacgtgctgctctcgcccgagtacgcggccgagcggcgcgcgctc
atcaccgacggggcctcgcacgagctgctccccggacgtgtcgacggcgtcgagccgttc
ctctcgccgctcgtggtcgagggcgacgcgcccgcgtccgccggcggcacgggcgagccg
acggtctcccgcgcgggcgagacccgcggcgacacctgccacctcgacatcgtggaccgg
tggggcaacatgatctccgccacgccctccggcggatggctccagtcgtcgccgttcatc
ccgtcgctcggcttctgcctcggcacgcgcctgcagatgacgtggctcgagcccggcggc
ccgtcgtcgctcgtgtccgggcgccggccgcgcacgacgctgacgcccaccctgatcacc
cgcgacggcgagcccgtcgaggcgctcggctcgcccggcggcgaccagcaggaccagtgg
cagctgccgtacctgctgcgcacgatcgtcggcggcttcagcccgcagcaggccgtggac
gcgccgaccttccacaccacgagcgtccccggatccttctggccgcgcacctggatgccc
ggcggcctcgtggtcgaggggcgcgtgggcgacgacgtgatcaccgacctccgggcccgc
gggcacgaggtggaggtcgtcggcgactggacgctcggccggctctcggccgtgacgcgg
gatcccgccaccggcctcctcggcgccgcggccaacccgcgtggggcgcaggggtacgcg
gtcgggcgatga

DBGET integrated database retrieval system