KEGG   Clavibacter michiganensis subsp. insidiosus: VO01_11760Help
Entry
VO01_11760        CDS       T03862                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
cmh  Clavibacter michiganensis subsp. insidiosus
Pathway
cmh00020  Citrate cycle (TCA cycle)
cmh00620  Pyruvate metabolism
cmh01100  Metabolic pathways
cmh01110  Biosynthesis of secondary metabolites
cmh01120  Microbial metabolism in diverse environments
cmh01130  Biosynthesis of antibiotics
cmh01200  Carbon metabolism
Module
cmh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cmh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VO01_11760
   00620 Pyruvate metabolism
    VO01_11760
Enzymes [BR:cmh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     VO01_11760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Amino_oxidase Hydrolase_4 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AJW79710
UniProt: A0A0D5CKC1
Position
complement(2486798..2488225)
Genome map
AA seq 475 aa AA seqDB search
MSATLGTLIKQLEPDWTIQIFERLGEVAMESSNPWNNAGTGHAALCELNYTPEKDGKIEI
GSATRINEQFQLSRQFWAHLVTAGAVPEPKEFINPTPHMTFVRGQENAEYLRRRFDAMRA
HPLFEAMEYTEDPAVIHSWAPLLVLQREKDEVIAATRFEGGTDVDFGALTNKLIDYLTEH
GAALHLNHEVRSLSKNPDGSWHLRVRNDVGRSTVEVDARFVFIGAGGGALHLLQKSGIPE
IKGFGGFPISGEWFRTDDPEIVAKHRAKVYGKAAIGSPPMSVPHLDTRVVGGETSLLFGP
YAGFSPRFLKKGSLLDLFTSIRPHNIIPMLAVAKDNLSLIKYLVSQLIASKETKFDALRE
FMPTADPKDWYQVTAGQRVQVMKKDAEKGGVLQFGTEVVAAADGSIAGLLGASPGASTAV
PIMLDVLERCFPDRIAGWKKPLTRMIPNYGTLVASDPKKTPKIIQETAEVLELQL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgacgctcggcaccctcatcaagcagctcgaacccgactggaccatccagata
ttcgagcgcctcggcgaggtggccatggagtcgagcaacccgtggaacaacgcgggcacg
ggccacgccgccctctgcgagctgaactacacgccggagaaggacgggaagatcgagatc
gggtccgcgacccgcatcaacgagcagttccagctctcccgccagttctgggcgcacctc
gtcacggcgggtgccgtgccggagcccaaggagttcatcaaccccaccccgcacatgacc
ttcgtgcgcggccaggagaacgccgagtacctccgccgccgcttcgacgcgatgcgcgcc
caccccctcttcgaggcgatggagtacacggaggaccccgcggtcatccactcctgggca
ccgctcctcgtgctccagcgcgagaaggacgaggtcatcgcggccacgcgcttcgagggc
ggcaccgacgtcgacttcggcgcgctcacgaacaagctcatcgactacctcacggagcac
ggcgcggccctgcacctcaaccacgaggtccgcagcctgtcgaagaaccctgacggcagc
tggcatctccgcgtccgcaacgacgtcggccgctccaccgtggaggtggacgcgaggttc
gtcttcatcggcgcgggcggcggcgcgctgcacctgctgcagaagtcgggcatccctgag
atcaagggcttcggcgggttccccatcagcggcgagtggttccgcacggacgaccccgag
atcgtcgccaagcaccgggcgaaggtctacggcaaggccgccatcggatccccgcccatg
tccgtgccgcacctcgacacgcgcgtggtggggggcgagacctcgctcctcttcggcccc
tacgccggcttcagcccgcgcttcctcaagaagggctcgctgctcgacctgttcacgtcg
atccggccgcacaacatcatcccgatgctcgccgtcgccaaggacaacctgagcctcatc
aagtacctcgtcagccagctcatcgcctccaaggagacgaagttcgacgcgctccgcgag
ttcatgcccacggccgacccgaaggactggtaccaggtcaccgccggccagcgcgtgcag
gtcatgaagaaggacgcggagaagggcggcgtgctgcagttcggcaccgaggtcgtcgcg
gcggccgacggcagcatcgcgggcctcctcggcgcgtcgccgggggcatccacggcggtc
ccgatcatgctcgacgtcctcgagcgctgcttccccgaccgcatcgccgggtggaagaag
ccgctgacgcgcatgatccccaactacggcacgctcgtcgcgtcggacccgaagaagacg
ccgaagatcatccaggagaccgccgaggtcctcgagctccagctctga

DBGET integrated database retrieval system