KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0904Help
Entry
CMM_0904          CDS       T00529                                 

Gene name
mqoA
Definition
(GenBank) putative malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00020  Citrate cycle (TCA cycle)
cmi00620  Pyruvate metabolism
cmi01100  Metabolic pathways
cmi01110  Biosynthesis of secondary metabolites
cmi01120  Microbial metabolism in diverse environments
cmi01130  Biosynthesis of antibiotics
cmi01200  Carbon metabolism
Module
cmi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cmi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CMM_0904 (mqoA)
   00620 Pyruvate metabolism
    CMM_0904 (mqoA)
Enzymes [BR:cmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     CMM_0904 (mqoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: CAN00941
UniProt: A5CPE3
Position
1039154..1040632
Genome map
AA seq 492 aa AA seqDB search
MSESAEPVDVVLVGGGIMSATLGTLIKQLEPDWTIQIFERLGEVAMESSNPWNNAGTGHA
ALCELNYTPEKDGKIEIGSATRINEQFQLSRQFWAHLVTAGAVPEPKEFINPTPHMTFVR
GKENAEFLRRRFDAMRAHPLFEAMEYSEDPAVIHSWAPLLVLQREKDEVIAATRFEGGTD
VDFGALTNKLIDYLTEHGAALHLNHEVRGLSQNPDGSWHLRIRNDVGRSTVQVDAKFVFI
GAGGGALPLLQKSGIPEIKGFGGFPISGEWFRTDDPEIVARHRAKVYGKAAIGSPPMSVP
HLDTRVVGGETSLLFGPYAGFSPRFLKKGSLLDLFASIRPHNIIPMLAVAKDNLSLIKYL
VSQLIASKEKKFDALREFMPTADPKDWYQVTAGQRVQVMKKDAKKGGVLQFGTEVVAAAD
GSIAGLLGASPGASTAVPIMLDVLERCFPDRIAGWKKPLTRMIPNYGTLVASDPKKTPKI
IQETAEVLELQH
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaatcagcggaaccggtagacgtcgtcctcgtcggcggcgggatcatgagcgcg
acgctcggcaccctcatcaagcagctcgaacccgactggaccatccagatcttcgagcgc
ctgggcgaggtcgccatggagtcgagcaacccgtggaacaacgcgggaacgggccacgcc
gccctctgcgagctgaactacacgccggagaaggacgggaagatcgagatcgggtccgcg
acccgcatcaacgagcagttccagctctcccgccagttctgggcgcacctcgtcacggcg
ggcgccgtgccggagcccaaggagttcatcaaccccaccccgcacatgacgttcgtgcgc
ggcaaggagaacgccgagttcctccgccgccgcttcgacgcgatgcgcgcccaccccctc
ttcgaggcgatggagtactcggaggatcccgcggtcatccactcatgggccccgctcctc
gtgctgcagcgcgagaaggacgaggtcatcgcggccacgcgcttcgagggcggcaccgac
gtcgacttcggcgccctcaccaacaagctcatcgactacctcacggagcacggcgcggcc
ctgcacctcaaccacgaggtccgcggcctgtcgcagaaccccgacggcagctggcacctc
cgcatccgcaacgacgtcggccgctcgaccgtgcaggtggatgcgaagttcgtcttcatc
ggggcgggcggcggcgcgctgcccctcctgcagaagtcgggcatccccgagatcaagggc
ttcggcggcttccccatcagcggcgagtggttccgcacggacgaccccgagatcgtcgcg
aggcaccgcgcgaaggtctacggcaaggcggccatcggatcgccgcccatgtccgtgccg
cacctcgacacgcgcgtggtggggggcgagacctcgctgctcttcggtccctacgccggc
ttcagcccgcgcttcctcaagaagggctcgctgctcgacctgttcgcgtcgatccggccg
cacaacatcatcccgatgctcgccgtcgcgaaggacaacctgagcctcatcaagtacctc
gtcagccagctcatcgcctcgaaggagaagaagttcgacgctctccgcgagttcatgccc
acggccgatccgaaggactggtaccaggtcacggccggccagcgcgtccaggtcatgaag
aaggacgcgaagaaggggggcgtgctgcagttcggcaccgaggtcgtcgcggcggcggac
ggcagcatcgccggcctcctcggcgcatcgcccggagcgtccacggcggtgccgatcatg
ctcgacgtcctcgagcgctgcttccccgaccgcatcgcgggatggaagaagcccctcacg
cgcatgatcccgaactacgggaccctcgtcgcgtccgacccgaagaagacgccgaagatc
atccaggagaccgccgaggtcctcgagctccagcactga

DBGET integrated database retrieval system