KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0971Help
Entry
CMM_0971          CDS       T00529                                 

Gene name
sdhD
Definition
(GenBank) putative succinate dehydrogenase, hydrophobic membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00020  Citrate cycle (TCA cycle)
cmi00190  Oxidative phosphorylation
cmi00650  Butanoate metabolism
cmi01100  Metabolic pathways
cmi01110  Biosynthesis of secondary metabolites
cmi01120  Microbial metabolism in diverse environments
cmi01130  Biosynthesis of antibiotics
cmi01200  Carbon metabolism
Module
cmi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cmi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cmi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CMM_0971 (sdhD)
   00650 Butanoate metabolism
    CMM_0971 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    CMM_0971 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF1691
Motif
Other DBs
NCBI-ProteinID: CAN01010
UniProt: A5CPL1
Position
complement(1116493..1116957)
Genome map
AA seq 154 aa AA seqDB search
MSDIAQQVSVERPRQPRQPRKQGGVNWEKWGWMYMRASGVVLVVLIFGHLYVNLIQGEGI
KAIDFAFVGGKLSDPFWKVWDIALLWLAVIHGANGMRTLVNDYAASPRTRTILKGALVTS
TVVLLVLGTLVVFTFDPCPAGQPADLLPSFCGDL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcgcacagcaggtcagcgtcgagcgcccccgccagccgcgccagccccgc
aagcagggcggcgtgaactgggagaagtggggctggatgtacatgcgcgcctcgggcgtc
gtgctcgtcgtgctcatcttcggccacctctacgtcaacctcatccagggcgagggcatc
aaggccatcgacttcgcgttcgtcggcggcaagctgtccgacccgttctggaaggtgtgg
gacatcgcgctgctctggctcgcggtcatccacggcgccaacggcatgcgcaccctcgtg
aatgactacgccgcgtcaccgcgcacccgcacgatcctcaagggcgcgctcgtcacgtcc
acggtggtcctgctcgtgctcggcacgctcgtggtcttcacgttcgacccgtgccccgcc
ggtcagcccgccgacctgctgccctccttctgcggcgacctctag

DBGET integrated database retrieval system