KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1631Help
Entry
CMM_1631          CDS       T00529                                 

Gene name
ppgK1
Definition
(GenBank) putative polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00010  Glycolysis / Gluconeogenesis
cmi00520  Amino sugar and nucleotide sugar metabolism
cmi01100  Metabolic pathways
cmi01110  Biosynthesis of secondary metabolites
cmi01120  Microbial metabolism in diverse environments
cmi01130  Biosynthesis of antibiotics
cmi01200  Carbon metabolism
Module
cmi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMM_1631 (ppgK1)
   00520 Amino sugar and nucleotide sugar metabolism
    CMM_1631 (ppgK1)
Enzymes [BR:cmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CMM_1631 (ppgK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hydant_A_N DUF4445
Motif
Other DBs
NCBI-ProteinID: CAN01683
UniProt: A5CRH4
Position
complement(1843281..1844102)
Genome map
AA seq 273 aa AA seqDB search
MSEDATTAIGIDIGGTGIKGAIVDVATGELKSERVKLPTPQGGEPEDIVATVKQIIDALG
EVPAGTPLGVCFPAAIVHGTTMSAANVSPSWIGLEAEKLFEERLGLEITFVNDADAAGYA
EARYGAAKDVRGLVIMTTLGTGIGTALIHDGVLIPNAELGHMDVAGRRDFERRASYAAKE
RAHLNWKRWAARLQVYYGQLEKLMWPELFIVGGGVSKNHKHFLPLLRLRTPIVPAELRNN
AGIMGAAALAAHAVGASTHAPAADLVDKTKPED
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggacgcgacgaccgcaatcggcatcgacatcggcgggaccggcatcaagggc
gccatcgtggacgtcgcgaccggcgagctgaagagcgagcgcgtgaagctgccgacgccg
cagggcggcgagcccgaggacatcgtggccaccgtgaagcagatcatcgacgcgctcggc
gaggtccccgcgggcacgccgctcggcgtgtgcttccccgccgcgatcgtgcacggcacg
accatgtcggcggccaacgtgtccccgtcctggatcggcctcgaggccgagaagctgttc
gaggagcgcctgggcctcgagatcacgttcgtcaacgacgcggacgccgccggctacgcc
gaggcccgctacggcgcggccaaggacgtgcgcggtctcgtcatcatgaccacgctcggc
acggggatcggcacggcccttatccacgacggcgtcctcatcccgaacgccgagctcggc
cacatggacgtcgcgggccgccgtgacttcgagcgccgcgcctcgtacgccgccaaggag
cgcgcgcacctcaactggaagcgctgggccgcccggctgcaggtgtactacggccagctc
gagaagctgatgtggccggagctgttcatcgtcggcggcggcgtgtccaagaaccacaag
cacttcctgccgctgctgcgcctgcgcaccccgatcgtgccggcggagctgcggaacaac
gcgggcatcatgggcgccgcggccctcgccgcgcacgcggtcggcgcgagcacgcacgcg
cccgcggccgacctcgttgacaagacgaagcccgaggactga

DBGET integrated database retrieval system