KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1880Help
Entry
CMM_1880          CDS       T00529                                 

Gene name
pycA
Definition
(GenBank) putative pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00020  Citrate cycle (TCA cycle)
cmi00620  Pyruvate metabolism
cmi01100  Metabolic pathways
cmi01120  Microbial metabolism in diverse environments
cmi01200  Carbon metabolism
cmi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CMM_1880 (pycA)
   00620 Pyruvate metabolism
    CMM_1880 (pycA)
Enzymes [BR:cmi01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     CMM_1880 (pycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 Dala_Dala_lig_C HlyD_3 HlyD_D23 ATP-grasp RnfC_N GCV_H NQRA
Motif
Other DBs
NCBI-ProteinID: CAN01936
UniProt: A5CS72
Position
complement(2125267..2128668)
Genome map
AA seq 1133 aa AA seqDB search
MFEKILVANRGEIAIRAFRAAVELGARTVAVYPHEDRHSLHRLKADEAYLIGEEGHPVRA
YLDVDEIIRVALQCGADAIYPGYGFLSENPDLARAAADNGIVFIGPSAGVLEMAGNKVTA
KEHATAAGVPVLASTPPSTDVELLLEQAEGIGFPIFAKAVAGGGGRGMRRVERAEDLEDA
LRAAMREADSAFGDPTMFLEQAVLRPRHIEVQILADATGETVHLFERDCSVQRRHQKVVE
IAPAPNLDPVIRDAMHAHAIAFARSIGYVNAGTVEFLLDTDGPRAGQHVFIEMNPRIQVE
HTVTEEVTDVDLVQSQMRIAAGETLAELGLGQDAIVLRGAALQCRITTEDPAQGFRPDTG
KITTYRSPGGGGIRIDGGTVATGAQISPHFDSMLAKLTCRGRDFPAAVTRAKRALAEFRI
RGVSTNIPFLQGVLDDPDFQAGDISTSFIDERPGLVRSNVSKDRGTKILNWLADVTVNQP
NGPRTAVVRPVDKLPDVDLRQPAPAGSRQRLLELGPRGFADALRAQTALAVTETTFRDAH
QSLLATRVRTRDLVAVAPYVARTTPELLSVEAWGGATYDVALRFLGEDPWERLASLREAL
PNVAIQMLLRGANTVGYTPYPTEVTDAFVQEAAATGVDVFRIFDALNDVERMRPAIDSVL
ATGTTVAEVALCYTGNLLDPAEDLYTLDYYLGLAERSVAAGAHVLAIKDMAGLLRPAAAE
RLVTALRREFDLPVHVHTHDTAGGQLATLLAASRAGADAVDVASAPMSGTTSQPSASALV
AALADTERDTGLSLDAVSDLEPYWEAVRRLYRPFESGLAGPTGRVYRHEIPGGQLSNLRQ
QAIALGLADDFELIEDMYAAADRILGRIPKVTPSSKVVGDLALQLAAAKADPADFERNPQ
DYDIPDSVVGFMAGELGDLPGGWPEPFRTRVLQGRDVRIGVTPVSAEDRAALRVPGVERR
RTLNHLLFPQPTEQFETIRELFGDLSVLDTDDYLHGLRPGQEHAVRISRGVEVLIGLEAV
GDADESGMRTVMVVMNGQLRPVFVRDRGIAVTTTAAERGDPAKPGHVSAPFSGVVTLKVE
EGQVVAAGQPVASIEAMKMEAAITSPVAGRVARLAVPTTQQVDAGDLLVVVEP
NT seq 3402 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagaagatcctcgtcgccaaccgcggggagatcgcgatccgcgcgttccgggcc
gccgtcgagctgggcgcccgcacggtcgccgtctacccgcacgaggaccggcactcgctg
caccggctgaaggcggacgaggcgtacctcatcggcgaggagggccaccccgtccgggcg
tacctcgacgtcgacgagatcatccgcgtggcgctccagtgcggcgccgacgccatctac
ccgggctacgggttcctctccgagaaccccgacctcgcgcgcgcggccgccgacaacggc
atcgtcttcatcggcccctccgccggggtgctcgagatggctggcaacaaggtcacggcc
aaggagcacgcgaccgcggccggcgtgccggtcctcgcgtcgacgccgccgtcgaccgac
gtggagctgctgctcgagcaggcggaggggatcggcttcccgatcttcgcgaaggccgtc
gcgggcggcggcggccgcggcatgcggcgcgtcgagcgcgcggaggacctcgaggacgcg
ctccgggccgccatgcgggaggcggacagcgccttcggcgacccgacgatgttcctcgag
caggcggtgctccggccgcggcacatcgaggtgcagatcctcgccgacgccacgggggag
accgtgcacctcttcgagcgcgactgctcggtgcagcgccggcaccagaaggtcgtggag
atcgccccggcgccgaacctcgacccggtgatccgcgacgccatgcacgcccacgcgatc
gcgttcgcccggagcatcggctacgtcaacgccggcacggtcgagttcctgctcgacacc
gacgggccgcgcgccgggcagcacgtcttcatcgagatgaacccgcgcatccaggtcgag
cacaccgtgaccgaggaggtgacggacgtcgacctcgtgcagtcgcagatgcgcatcgcg
gcgggggagaccctcgccgagctcggcctcggccaggacgcgatcgtgctgcgcggcgcg
gcgctccagtgccgcatcacgaccgaggacccggcgcagggcttccgcccggacaccggc
aagatcacgacgtaccgctcgccgggcggcggcgggatccgcatcgacggcggcacggtc
gcgaccggcgcgcagatcagcccgcacttcgactcgatgctcgcgaagctcacctgccgc
gggcgcgacttcccggccgccgtcacgcgggccaagcgcgccctggccgagttccggatc
cgcggcgtctccacgaacatccccttcctccagggtgtgctcgacgaccccgacttccag
gcgggcgacatcagcacctccttcatcgacgagcggccggggctcgtgcgcagcaacgtg
tcgaaggaccgcgggacgaagatcctcaactggctcgccgacgtcaccgtcaaccagccg
aacgggccgcgcaccgcggtcgtgcggcccgtcgacaagctgcccgacgtcgacctccgg
cagccggcgcccgcgggatcccgccagcggctcctcgagctcggaccccgcggcttcgcc
gacgccctccgtgcgcaaaccgccctcgcggtcacggagacgacgttccgtgacgcgcac
caatcgctgctcgcgacgcgcgtgcgcacccgcgacctcgtggccgtcgccccgtacgtc
gcgcgcacgacgcccgagctcctctccgtcgaggcctggggcggcgccacctacgacgtg
gcgctgcgcttcctcggcgaggatccgtgggagcggctcgcgtcgctgcgcgaggcgctg
ccgaacgtcgcgatccagatgctgctgcgcggcgccaacacggtgggctacacgccgtac
ccgacggaggtcaccgacgcgttcgtgcaggaggccgccgcgaccggcgtcgacgtgttc
cgcatcttcgacgcgctcaacgacgtcgagcgcatgcgccccgcgatcgactccgtgctc
gccaccggcaccacggtggccgaggtcgccctctgctacacgggcaacctgctggatccc
gccgaggacctctacacgctcgactactacctcggcttggcggagcggagcgtcgccgcg
ggcgcgcacgtcctcgcgatcaaggacatggccgggctcctccgccccgcggccgccgag
cgcctcgtcaccgcgctccgccgcgagttcgacctccccgtccacgtgcacacccacgac
acggcgggcggccagctcgcgaccctgctcgcggccagccgcgccggggccgacgcggtc
gacgtcgcgagcgcgcccatgtcgggcaccacgagccagccgtcggcgtccgcgctcgtc
gccgccctcgcggacaccgagcgcgacacgggcctctcgctcgacgcggtcagcgacctc
gagccgtactgggaggcggtccgccgcctgtaccggccgttcgagtccgggctcgcgggc
ccgaccgggcgcgtgtaccggcacgagatccccggggggcagctctcgaacctccgccag
caggcgatcgcgctcggcctcgccgacgacttcgagctcatcgaggacatgtacgccgcc
gccgaccggatcctcggccgcatccccaaggtcacgccgtcgtccaaggtggtcggcgac
ctcgccctccagctggccgccgcgaaggccgacccggccgacttcgagcgcaacccgcag
gactacgacatccccgactcggtggtcggcttcatggcgggcgagctgggcgacctgccc
ggcggctggccggagccgttccgcacccgggtcctccagggacgcgacgtgcgcatcggc
gtcacgcccgtctccgccgaggaccgcgccgcgctgcgcgtgcccggcgtcgagcggcgg
cgcacgctcaaccacctcctgttcccgcagccgacggagcagttcgagaccatccgcgag
ctcttcggcgacctctccgtgctcgacaccgacgactacctgcacggcctccgcccgggg
caggagcacgcggtgcggatcagccggggcgtcgaggtcctcatcggcctcgaggccgtg
ggtgacgcggacgagtcggggatgcggaccgtcatggtcgtcatgaacggacagctccgc
cccgtcttcgtccgagaccgcggcatcgccgtgaccacgaccgccgccgaacgcggtgac
cccgcgaagcccgggcacgtgtcggcaccgttctccggcgtcgtcacgctgaaggtggag
gagggccaggtcgtcgccgccggccagcccgtcgcgtccatcgaggcgatgaagatggag
gcggccatcacgtcgcccgtcgcgggacgcgtagcgcgcctcgcggtgccgaccacgcag
caggtcgacgcgggcgacctgctcgtcgtcgtcgagccctag

DBGET integrated database retrieval system