KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_1923Help
Entry
CMM_1923          CDS       T00529                                 

Gene name
ggtA
Definition
(GenBank) putative gamma-glutamyltranspeptidase (ZP_00227294.1| COG0405: Gamma-glutamyltransferase [Kineococcus radiotolerans SRS30216]; NP_630062.1| putative transferase [Streptomyces coelicolor A3(2)]). g_glut_trans: gamma-glutamyltranspepti; High confidence in function and specificity
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
cmi00430  Taurine and hypotaurine metabolism
cmi00460  Cyanoamino acid metabolism
cmi00480  Glutathione metabolism
cmi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CMM_1923 (ggtA)
   00460 Cyanoamino acid metabolism
    CMM_1923 (ggtA)
   00480 Glutathione metabolism
    CMM_1923 (ggtA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cmi01002]
    CMM_1923 (ggtA)
Enzymes [BR:cmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     CMM_1923 (ggtA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     CMM_1923 (ggtA)
Peptidases and inhibitors [BR:cmi01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   CMM_1923 (ggtA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: CAN01979
UniProt: A5CSB5
Position
complement(2170932..2172743)
Genome map
AA seq 603 aa AA seqDB search
MTFRAPDAFTTRPTLRGTFGMSASTHWLASGTGQAVLERGGNAFDAAVAAAFVLHVVEPH
LNGPGGDMTAVVKVAGEDAPKLLMGQGSAPAAASPERFRQEGLDRVPGAGALAAAVPAAV
DAWLLLLRDHGTWELGDVWAFAIGYARDGHPVLESVRRTIAGVGDLFREHWSASAAFWMP
DGEAPVAGSLVRNPAWAAAMERILAEASTAAGAGATREQRIEAARTVWAEGFVAEEMVAS
VQDPHRHSTGADHAGLLTAADLAGSRASWEDAVSIGFRGLRIWKTDAWGQGPALLQALMI
LDGFTDEEIDPATAAGIHRIIEAQKLALADREAYYGDAVPGGAPLDVLLSPEYAAERRAL
ITDEASHELRPGRVDGVEPFLPPLVVEGDSPASAGGTGEPTVSRSGETRGDTCHLDIVDR
WGNMISATPSGGWLQSSPFIPALGFCLGTRLQMTWLEPGGPSSLVPGRRPRTTLTPTLIT
RDGEPVGALGSPGGDQQDQWQLPYLLRTIVGGFSPQQAVDAPTFHTTSVPGSFWPRTWTP
GGLVVEGRVGADVIADLRARGHEVELVGDWTLGRLSAVTRDPATGLLGAAANPRGAQGYA
VGR
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
gtgacgttccgcgcgcccgacgcattcaccacccgacccacgctccgcggcacattcggc
atgagcgcctcgacccactggctcgcgtccggcaccggccaggccgtgctggagcgcggc
ggcaacgccttcgacgcggcggtcgccgccgcgttcgtgctgcacgtggtggagccgcac
ctcaacgggccgggcggcgacatgaccgccgtcgtgaaggtcgcgggggaggatgcgccg
aagctgctcatggggcagggatccgcgcccgccgccgccagccctgagcgcttccgccag
gagggcctcgaccgcgtgcccggcgccggcgcgctggccgcggccgtgcccgccgcggtc
gacgcgtggctgctgctgctgcgcgaccacggcacgtgggagctcggcgacgtgtgggcc
ttcgccatcgggtacgcgcgcgacgggcaccccgtgctcgagagcgtccgtcgcaccatc
gcgggcgtcggcgacctgttccgcgagcactggtccgcgtctgccgcgttctggatgccg
gacggcgaggcgcccgtcgcggggtcgctcgtgcgcaacccggcgtgggcggcggcgatg
gagcggatcctcgccgaggcgtcgaccgcagccggcgctggcgcgacgcgcgagcagcgc
atcgaggccgcccgcaccgtctgggccgagggcttcgtcgcggaggagatggtcgcgagc
gtgcaggacccgcaccggcactcgaccggcgccgaccacgcgggcctcctcaccgccgcg
gacctcgccggctcgcgcgcgtcgtgggaggacgcggtgtcgatcgggttccgcggcctg
cgcatctggaagaccgacgcctggggccaggggccggcgctgctgcaggcgctgatgatc
ctcgacgggttcacggacgaggagatcgacccggcgacggccgcggggatccaccgcatc
atcgaggcgcagaagctcgccctcgcggaccgcgaggcgtactacggcgacgccgtgccg
ggcggcgcgcccctcgacgtgctgctgtcgcccgagtacgcggccgagaggcgcgcgctc
atcaccgacgaggcctcgcacgagctgcgtcccggacgcgtcgacggcgtcgagcccttc
ctgccgccgctcgtcgtcgagggtgactcgcccgcctccgccggcggcacgggcgagccg
acggtctcccgctcgggcgagacccgcggcgacacctgccacctcgacatcgtcgaccgg
tggggcaacatgatctccgccacgccctccggcggctggctccagtcgtcgccgttcatc
cccgcgctcggcttctgcctcggcacccgcctgcagatgacgtggctcgagcccggcggc
ccgtcgtcgctcgtgcccggccgccggccgcgcacgacgctgacgcccacgctcatcacg
cgcgacggcgagcccgtcggggcgctcggctcgcccggcggcgaccagcaggaccagtgg
cagctgccctacctgctgcggacgatcgtcggcgggttctcgccgcagcaggccgtggac
gcgcccacgttccacacgacgagcgtccccgggtccttctggccgcgcacctggacgccc
ggcggcctcgtggtcgaaggccgtgtgggcgccgacgtgatcgccgacctccgggcccgc
gggcacgaggtggagctcgtcggcgactggacgctggggcggctctcggccgtgacgcgg
gatccggcgaccggcctgctgggtgcggcggccaacccgcgcggggcgcaggggtacgcg
gtcgggcgatga

DBGET integrated database retrieval system