KEGG   Clavibacter michiganensis subsp. michiganensis: pCM1_0020Help
Entry
pCM1_0020         CDS       T00529                                 

Gene name
celA
Definition
(GenBank) cellulase
  KO
K20628  expansin
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase CBM_2 DPBB_1 Pollen_allerg_1
Motif
Other DBs
NCBI-ProteinID: CAM98473
UniProt: A5CLK3
Structure
PDB: 

Position
pCM1:17651..19891
Genome map
AA seq 746 aa AA seqDB search
MRKASVEVVFSAAGWLPYDPYMTFRQVRASLVLRLVLLLALVVGTTSAAFAAPVSAATVA
GPVAAASSPGWLHTAGGKIVTASGAPYTIRGIAWFGMETSSCAPHGLDTITLAGGMQHIK
QMGFTTVRLPFSNQCLAASGVTGVSADPSLAGLTPLQVMDHVVASAKSAGLDVILDQHRP
DSGGQSELWYTSQYPESRWISDWRMLAKRYAAEPTVIGVDLHNEPHGAATWGTGAATTDW
RAAAERGGNAVLAENPNLLVLVEGIDHEADGSGTWWGGALGLVGNAPVRLSVANRVVYSP
HDYPSTIYGQSWFSASNYPANLPGIWDAHWGYLAKKDIAPVLVGEFGTKFETTSDKQWLN
TLVGYLSSTGISSSFWAFNPNSGDTGGIVKSDWVTPEQAKLDALAPILHPSPGSGPGSGG
SGSQPAPQPDPANPGAVSAKWQPGSSWASGYVANIDVTATAAVTGWTVSWASPGTTRVVN
SWGMRCSVASGTVSCTGTDWASKLAAGQTVHVGLQASGGPAPSSPRLTATAAAVPPAQPT
PPARPTTHGRATHYSLGQGNTIANGNCSMPAVPADRMYVAVSSPEYSGAAACGTFLDVTG
PKGTVRVQVADQCHGCEVGHLDLSEEAFRALGDFNAGIIPISYVTVRDPAGPTVAIRVKE
GSSRWWAGLQVLNAGNRIDRVEIQAGRQWLPLTRTDYGYWVTPSPIQDGPLTVKVTDQYG
RAVVLPGLRMAPGEIQRTASRFYPVH
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaaggcgtctgtggaagtggttttcagtgcggccggatggcttccctacgatcct
tatatgacatttcgccaagttcgtgcatccttagtgcttcggctcgtccttctccttgcg
ttggtggtcggcaccacgtccgccgcattcgctgcgcctgtctcagccgccaccgtagcg
gggcccgttgcggcggcctcatcgcctggatggctgcatacggcgggcgggaagatcgtc
accgcctccggtgctccgtacacgatccgtggcatcgcttggtttggcatggagacgtcg
tcgtgcgcgccgcatggcctggacaccatcaccctcgcgggcggtatgcagcacatcaag
cagatggggttcacgaccgtgcggttgcccttctcgaaccagtgcctcgccgcgtccggc
gtcacgggtgtcagtgcggacccgtcactcgccgggctcacgccgctgcaggtcatggac
cacgtcgtcgcgtcggcgaagagcgccggtcttgacgtgatcctcgaccagcaccggccg
gactcgggcggccagtctgagctctggtacacatcgcagtatccggagtcgcggtggatc
tccgactggaggatgctcgcaaagcgctatgcagccgaacccaccgtcatcggtgtagac
ctccacaacgaaccgcacggtgcggcgacctggggtaccggggcggccaccactgactgg
cgggcagcggccgagcgtggcgggaatgcggtcctcgccgagaacccgaacctcctcgtg
ctcgtggagggcatcgaccacgaggccgacggatctggcacctggtggggcggcgcgctc
gggttggtaggcaatgcacctgtgcggctgtcggtcgcgaatcgcgtcgtctactccccg
catgactacccctcgaccatttacggccagtcatggttctccgcatcaaactatccggcg
aacttgccgggtatttgggacgcccactggggatacctggcgaagaaggacattgccccg
gttctcgtgggtgagttcggtacgaagttcgagacgacgagcgacaagcagtggctcaac
accctcgttggatatctgtcgagcacggggatcagctcgtcgttctgggccttcaacccg
aatagtggcgacaccggcggtatcgtgaagtccgactgggtgaccccggagcaggcgaag
ctcgacgccctggcgccgatcttgcacccgtcgcccgggtcgggtccgggatccggcgga
tccgggtctcagccagcgccgcagcccgatccggcgaacccgggcgctgtatcagcgaag
tggcagcctggcagctcctgggcatcgggctacgtagcgaacatcgacgtcaccgcgaca
gccgctgtcacgggatggaccgtctcatgggccagccccggaaccacccgcgtcgtcaac
agttggggcatgcgctgcagcgtcgcctccggcaccgtgagctgcaccggcacggactgg
gcgagcaagctcgccgccggccagaccgttcacgtcggcctacaggcgtcgggtggcccg
gctccctcttcaccacgactcaccgctacagcggccgcggtgccgcctgcccagcccaca
ccgcccgctcggcccacgacgcatggccgtgccacgcactactcgctcggccagggcaac
acgatcgcgaacggcaactgctccatgccggctgtccctgcagaccgaatgtacgttgcg
gtcagcagccccgagtacagcggtgccgccgcgtgcggcaccttcctcgacgtcactggc
cccaagggcaccgtccgcgttcaggtcgctgaccagtgccatgggtgcgaggtcggacat
ctcgatctgagcgaggaagcgttccgcgccctcggcgacttcaatgccggcatcatcccg
atcagctacgtcaccgtccgggatccggccgggcctaccgtcgccatccgagtcaaagaa
ggctcatcccgctggtgggcaggtctgcaggtcctgaacgccggcaaccgcattgaccgt
gtcgaaatccaggccgggagacagtggctgcccctcactcgcaccgactacgggtactgg
gtgacgccgtccccgattcaggacggccccctgaccgtgaaggtgaccgaccagtatggt
cgcgcggtcgtgctccccggcctccgcatggcacccggggagatccagcgcacggcctcc
cgcttctaccctgtgcactga

DBGET integrated database retrieval system