KEGG   Corynebacterium minutissimum: NCTC10288_01319Help
Entry
NCTC10288_01319   CDS       T05574                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
cmin  Corynebacterium minutissimum
Pathway
cmin00030  Pentose phosphate pathway
cmin00480  Glutathione metabolism
cmin01100  Metabolic pathways
cmin01110  Biosynthesis of secondary metabolites
cmin01120  Microbial metabolism in diverse environments
cmin01130  Biosynthesis of antibiotics
cmin01200  Carbon metabolism
Module
cmin_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
cmin_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:cmin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NCTC10288_01319 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NCTC10288_01319 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmin04147]
    NCTC10288_01319 (zwf)
Enzymes [BR:cmin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     NCTC10288_01319 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     NCTC10288_01319 (zwf)
Exosome [BR:cmin04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NCTC10288_01319 (zwf)
  Exosomal proteins of colorectal cancer cells
   NCTC10288_01319 (zwf)
  Exosomal proteins of bladder cancer cells
   NCTC10288_01319 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: SQI00015
UniProt: A0A2X4UBP3
Position
1:1417648..1419180
Genome map
AA seq 510 aa AA seqDB search
MSTTSAWVNPLRNAKDKRLPRIAGPSGMVIFGVTGDLARKKLLPAIYDLANRGLLPAGFT
LVGYGRRDWDKDAFCAYVREAAEAGARTTFSEHVWEHLAKGIEFVQGNFDDAGFDKLSAR
LSELNTSRGTGGNWAYYLSVPPEFFSDICHQLERVGMADSTDNSWRRVIIEKPFGHDQAS
ARELNEIVNAVFPESSVFRIDHYLGKETVQNIMALRFANQIFEPMWNAHYIDHVQITMAE
DIGLGGRAGYYDGIGAARDVIQNHLLQLLALVAMEEPSSFAPAALQAEKIKVLEATQAVH
PLNKTTARGQYSAGWQGSVYVKGLREEEGFDPESTTETYAACTLKVNSRRWAGVPFYLRT
GKRLGRRVTEIALVFKTAPHQPFDQGQAEALDQNAVVIRVQPDEGVTMRFGSKVPGSTME
VRDVNMDFAYASAFTEESPEAYERLILDALLDESSLFPTNREVELSWSILDPIIQYWSGI
GQPEQYRAGTWGPESADRMLRRQGHSWRRP
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactaccagcgcgtgggtcaacccgttgcgcaacgcgaaagacaagcgtcttccg
cgcattgctggaccctctggcatggtgattttcggcgtgaccggtgacttggcacgtaaa
aagctcctgccggccatttacgatttggccaaccgcggtctgttgccggccggctttacc
cttgtgggctacgggcgccgtgactgggacaaggacgccttctgcgcctatgtccgcgag
gctgcagaagcaggcgcccgcactaccttcagtgagcatgtctgggagcacctagccaag
ggcatcgaattcgtccaaggcaatttcgatgatgccggcttcgacaagctctcagcgcgg
ctgtctgagctcaacacctcccgtggcacgggtggtaactgggcgtattacttgtccgtt
ccaccagagttcttctccgatatttgccaccaactggaacgcgttggcatggccgatagc
acggacaactcatggcgccgcgtcatcattgagaagcccttcggccacgatcaggcttcc
gcccgtgagctcaatgaaatcgttaatgccgtcttcccagaatcgtcggtcttccgtatc
gaccactacctaggcaaagaaaccgtgcagaacatcatggcactgcgctttgccaatcag
atttttgagccaatgtggaatgctcactacatcgaccacgtccagatcacaatggcggag
gacatcggccttggtggacgtgccggctactacgacggtattggcgctgcgcgcgacgtt
attcagaatcacctgctgcagttgcttgcacttgtggccatggaggaaccttcctccttt
gccccggcagcccttcaggccgaaaaaatcaaggttctggaggccacacaagcggtgcat
ccgctcaacaagaccactgctcgcggtcaatactcggccggttggcaaggttcggtgtat
gtcaagggtttgcgtgaagaagaaggcttcgatcccgaatccactaccgagacctacgcc
gcgtgcaccctcaaggtgaattctcgccgttgggcaggagtccccttctacctccgcacg
ggcaagcgcttgggccgccgcgtaaccgagattgccctcgtgttcaaaactgctccgcac
caaccctttgaccaaggtcaagccgaagcgcttgatcagaacgcagtcgttatccgtgtt
cagccggatgaaggcgtgactatgcgctttggttcaaaggttcccggttccaccatggaa
gtccgtgatgtcaacatggacttcgcttacgcctccgcctttacagaggagtcccccgag
gcctacgagcgcctcatcctcgatgctctattggacgagtcgtcgctcttccccaccaac
cgtgaggtggagttatcctggtccatcctggaccctatcatccagtattggtctggcatt
ggccagccggaacagtatcgcgcgggaacgtggggacccgagtccgctgatagaatgctg
cgccgtcagggtcactcctggcgccgtccgtag

DBGET integrated database retrieval system