KEGG   Christensenella minuta: B1H56_01700Help
Entry
B1H56_01700       CDS       T05665                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10441  ribose transport system ATP-binding protein [EC:7.5.2.7]
Organism
cmiu  Christensenella minuta
Pathway
cmiu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cmiu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    B1H56_01700
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cmiu02000]
    B1H56_01700
Enzymes [BR:cmiu01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.7  ABC-type D-ribose transporter
     B1H56_01700
Transporters [BR:cmiu02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    B1H56_01700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase AAA AAA_29 mIF3 VirE AAA_23
Motif
Other DBs
NCBI-ProteinID: AYH39316
UniProt: A0A136Q6F2
Position
348944..350464
Genome map
AA seq 506 aa AA seqDB search
MENEYYLEMSGISKTFPGAKVLDSIEFNVKAGEVRALMGENGAGKSTLIKILGGIYDMDP
GQGTIRINGQEAKINTVQDAQHYGIGIIHQEISLAENMSIADNLFMGKEIKGGALLNDRE
MVRRSQAVLEEMGLGVDARTKVRDLSIAKQQMVEISRALLSNARIIVMDEPTSSLTKTEI
DQLFLQIDKLKKSGIAIIYISHRMDEIFEIADSISILRDGKMIGTDTVENLTQDKVISMM
VGRELSEIFKRDGKIDVGEVCLEVKHYSNKKINDINFSLRKGEIVGFAGLVGAGRTELAR
AIFGIDKVDSGELYINGELVNIQNTQDAIRHGIGYVPEDRKTEGLFLMHTIKYNTSIVVL
DKFIKNVGVNKKYENELTGKYADALSIKMTSPEQKVQFLSGGNQQKVVLGKWMAADPDIF
ILDEPTRGVDVGAKAEIYQLIYGLAKQGKAVMLISSEMEEIINLSDRIVVMHEGSVTGVL
DNNETSRARQEEIMWFASGGKENAKN
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgaatactatctggaaatgtcgggcatcagtaagacatttccgggcgctaag
gtgcttgacagcattgaattcaatgtgaaggccggcgaagtgcgtgccctgatgggcgag
aacggcgcgggaaaatcgaccttaattaaaatattgggcgggatctatgacatggacccc
ggacagggaacgatccggatcaacgggcaggaagccaaaatcaatacggtacaggatgca
cagcattacggaattggtatcatccaccaggaaatcagcctcgcggagaacatgtcgatc
gcggataacctctttatggggaaagaaatcaagggcggagcgcttttgaacgaccgggaa
atggttcgcaggtcgcaggcggtcctggaagagatggggctgggcgtcgacgcacgtaca
aaggtgcgggacctgagcattgcgaaacaacagatggtggagatcagcagggcgctgctg
tcgaacgccaggatcatcgtgatggacgaaccgacttcttctttgacaaaaacagagata
gatcagctttttttgcagatagataaactgaaaaaatcagggattgccattatttatatc
tctcacaggatggacgaaatttttgaaatagcggattctatttccattttgcgggacgga
aaaatgattgggacggatacggtggaaaatctgacgcaggacaaggtaatcagcatgatg
gttggccgcgagctttcggagattttcaaacgggacgggaaaatagatgtgggcgaagtt
tgcctggaagtcaagcattattccaacaagaaaattaacgatattaatttttccctgcgg
aaaggggaaatcgtcgggtttgccggccttgtaggcgcgggacggactgagcttgccagg
gcgatctttgggatcgacaaggtggattccggggagctttacataaacggcgaactggtg
aatattcaaaatacacaggatgcgatcaggcatggcatcgggtatgttcctgaagacagg
aaaacggaagggctgttcctgatgcacacaatcaaatacaacacctctatcgtcgtgctg
gataaattcatcaagaatgtaggcgtcaacaaaaaatatgaaaacgagctgaccggaaag
tacgcggacgccctctctatcaagatgacgtctccggaacaaaaggtgcagttcctttcc
ggcggcaaccagcagaaggtggtccttgggaaatggatggctgccgacccggatattttt
atcctcgacgagccgacgaggggcgtcgacgttggcgcgaaggctgaaatctaccagctg
atctacggacttgccaagcagggaaaagccgttatgctgatttcctctgaaatggaggag
atcatcaacctcagcgaccggatcgtcgttatgcacgaaggttcggtgacgggagtgctt
gacaataacgaaacatcaagggcaaggcaggaagaaattatgtggtttgcttcgggaggg
aaagaaaatgcaaaaaattaa

DBGET integrated database retrieval system