KEGG   Christensenella minuta: B1H56_03110Help
Entry
B1H56_03110       CDS       T05665                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cmiu  Christensenella minuta
Pathway
cmiu00051  Fructose and mannose metabolism
cmiu01100  Metabolic pathways
cmiu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cmiu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    B1H56_03110
Enzymes [BR:cmiu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     B1H56_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AYH39560
UniProt: A0A136Q3B7
Position
644568..645200
Genome map
AA seq 210 aa AA seqDB search
MAELSYMDRRLEMLEIIRFLYDRKLTNAAGGNLSERVAENRVLITPTMMSEHHRCRLNPE
DLMIIDYDCNIIEGPDKLSRESKMHTMLLKNFPEFGAVIHAHPQFSMCFAAFSQPIPSVT
EATMKMGDCGVIHQAWAYSEELAIRTNEYFMNNRERAQKMGLEGILPQHGIVAAAPTLNK
AYSIVERVEYDAMANIFKPAVYAAQENLHE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattatcttatatggatagaagattggaaatgctggaaatcattcggttcttg
tatgaccgcaagcttacgaatgcagcaggcgggaatctttccgagcgtgtggcggaaaac
cgcgtattgattacacctactatgatgtcggagcatcataggtgccgcctgaacccggaa
gacctgatgattatcgactatgactgcaacattattgaggggccggacaagctttcgcgt
gaaagcaagatgcacacgatgctgcttaaaaattttccggagtttggcgcggtgatccat
gcgcatccgcagttttccatgtgttttgcggcgttcagccagccgattccgtccgtgacg
gaagcgaccatgaaaatgggagactgcggcgtgatccatcaggcgtgggcctattccgag
gagcttgcgatccgtactaacgagtattttatgaacaatcgtgagcgcgcacagaaaatg
gggctcgaagggatactgccgcagcacggcatcgtcgcggcggcacctacgcttaataaa
gcctacagcatcgtagagcgtgtggaatatgatgcgatggcgaacatctttaaaccggcg
gtatatgcggcgcaggagaatttacacgaatga

DBGET integrated database retrieval system